DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and ACCSL

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001027025.2 Gene:ACCSL / 390110 HGNCID:34391 Length:568 Species:Homo sapiens


Alignment Length:397 Identity:92/397 - (23%)
Similarity:151/397 - (38%) Gaps:100/397 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DPTTFG--NLKAADE--TMKAVLHSLESGKYN-------GYASTQGHEIARKAVAKYSAHQ-RPD 170
            |..|.|  ||..::.  .|..:...|:....|       .|...:|....|:.||::..:. |..
Human   164 DKNTLGFINLGTSENKLCMDLMTERLQESDMNCIEDTLLQYPDWRGQPFLREEVARFLTYYCRAP 228

  Fly   171 GEIDANEVVLCSGCSSALEYCILA--LADRGQNVLVPRPGFCLYYTLAQGLDIEVRYY---DLLP 230
            ..:|...||:.:||.|.  :|.||  |.|.|:..|||.|    :|   .|.....|.|   :|:|
Human   229 TRLDPENVVVLNGCCSV--FCALAMVLCDPGEAFLVPAP----FY---GGFAFSSRLYAKVELIP 284

  Fly   231 DQQWRADLVQLES------------LIDENTAALL-------------INNPSNPCGSVFDEKHL 270
                    |.|||            .:|:...|||             :.||.||.|.::....|
Human   285 --------VHLESEVTVTNTHPFQLTVDKLEEALLEARLEGKKVRGLVLINPQNPLGDIYSPDSL 341

  Fly   271 RELIAICERHYLPIIADEIYEHFVFPGS----KHLAVSSLTTEVPVLSCGGLTKRFLVPGWRMGW 331
            .:.:...:|:.|.:|.||||...||..|    ..|::.||..........|.:|.|.:.|:|.|.
Human   342 MKYLEFAKRYNLHVIIDEIYMLSVFDESITFHSILSMKSLPDSNRTHVIWGTSKDFGISGFRFGA 406

  Fly   332 IIVHDRKNRLRDAIVGLKNMCGRILGSNTIIQGALPDILTKTPQSYFDGVIDVLHSNAML---AY 393
            :..|:::      :....:..|.:...:.|.|..|..:|..|  .:.|.|  .|.:|...   |:
Human   407 LYTHNKE------VASAVSAFGYLHSISGITQHKLCQLLQNT--EWIDKV--YLPTNCYRLREAH 461

  Fly   394 KML-KQVRGLDPVMPNGAMYMMIGVSIERFPEFKDDTHFVQE--------------------MVN 437
            |.: .:::.|:....|.:..:.:.:::::   :.|...|.:|                    |..
Human   462 KYITAELKALEIPFHNRSSGLYVWINLKK---YLDPCTFEEERLLYCRFLDNKLLLSRGKTYMCK 523

  Fly   438 EQSVFCL 444
            |...|||
Human   524 EPGWFCL 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 92/397 (23%)
AAT_like 112..475 CDD:99734 92/397 (23%)
ACCSLNP_001027025.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PLN02607 150..561 CDD:215327 92/397 (23%)
AAT_like 171..546 CDD:99734 89/390 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.