DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and Accsl

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_011237947.1 Gene:Accsl / 381411 MGIID:3584519 Length:584 Species:Mus musculus


Alignment Length:411 Identity:90/411 - (21%)
Similarity:164/411 - (39%) Gaps:63/411 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DPTTFGNLKAADETM----------KAVLHSLESGKYNGYASTQGHEIARKAVAKYSAHQ-RPDG 171
            :|:.:.||..::..:          ::.::.|:..:.. |:..:|....|:.:|.:..|. :...
Mouse   192 NPSGYINLSTSENKLCLDLITARLTQSDMNLLDEAQLQ-YSDWKGQPFLREELASFLTHYCKAPT 255

  Fly   172 EIDANEVVLCSGCSSALEYCILALADRGQNVLVPRP---GFCLYYTLAQGLD-IEVRYYDLLPDQ 232
            .:|...||:.:||||......:.|.|.|..:|:|.|   ||.....|...:: |.|.....:|  
Mouse   256 PLDPENVVVLNGCSSVFASLAMVLCDPGDALLIPTPCYNGFVFSSHLYSKIELIPVHLESQVP-- 318

  Fly   233 QWRADLVQLESLID-------------ENTAALLINNPSNPCGSVFDEKHLRELIAICERHYLPI 284
              |::|...:..:|             :....|::.||.||.|.|:.:..|:|.:...:.|.|.:
Mouse   319 --RSNLDSFQLTVDKLKLALTQAKKKAKKVKGLVLINPQNPLGDVYTQSSLQEYLVFAKTHKLHV 381

  Fly   285 IADEIYEHFVFPGS----KHLAVSSLTTEVPVLSCGGLTKRFLVPGWRMGWIIVHDRKNRLRDAI 345
            |.||||...||..|    ..|::..|..........|.:|.|.:.|.|.|.:..|:::      :
Mouse   382 IMDEIYMLSVFEPSVTFHSVLSIKDLPDPNMTHMIWGTSKDFGMSGIRFGVLYTHNKE------V 440

  Fly   346 VGLKNMCGRILGSNTIIQGALPDILTKTPQSYFDGV-IDVLHSNAMLAY----KMLKQVRGLDPV 405
            .......|...|.:.|.|..|..:|  ..:.:...| :...||....||    |:||.::     
Mouse   441 ASAMKAFGYHHGVSGITQYKLCRLL--QDKEWISKVYLPKNHSRLQKAYSYITKILKDLK----- 498

  Fly   406 MP--NGAMYMMIGVSIERF--PEFKDDTHFVQEMVNEQSVFCLPGS---CFEYPGYVRIVLTVPG 463
            :|  ||...:.:.::::.:  |...|....:.:...::.:....|.   |.| ||:.|:|.....
Mouse   499 IPFYNGGSGLFVWINLKAYLSPCTFDQEQILHQRFRDKKLLLSSGKSYMCIE-PGWFRLVFAETH 562

  Fly   464 AMIEEACSRIAEFCDRHYKKE 484
            ..::.|..|.......|.|.|
Mouse   563 LHLQVAMDRFCHVLAEHKKHE 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 87/406 (21%)
AAT_like 112..475 CDD:99734 87/400 (22%)
AccslXP_011237947.1 PLN02450 156..571 CDD:178069 86/397 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.