DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and CG1640

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_727696.2 Gene:CG1640 / 32292 FlyBaseID:FBgn0030478 Length:575 Species:Drosophila melanogaster


Alignment Length:549 Identity:126/549 - (22%)
Similarity:217/549 - (39%) Gaps:151/549 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VTPNCDVVDQALAELQLQSQDI------------------RKQQDLVDTTATSSSSRKRSGWEIK 82
            :.|....|..||.:.|.|.|..                  |..:.....|.|::::.:|.|  ..
  Fly    13 IKPAAATVSAALQQHQRQQQQYVIRRWKSFLHNNSNNANRRAAKSTATATVTAAATSQRHG--TS 75

  Fly    83 GS-------KLSLNTHNRIRNIVESL---KIKPN-----------------------------PE 108
            |.       :.|.:|.:::.:..::|   .|.||                             |.
  Fly    76 GDFIQPLDVRRSFSTSHKMPSSSKALTLDNINPNFIAMEYAVRGPLVIRAGEIEKELEKGVKKPF 140

  Fly   109 KPMIPLSIGD-------PTTFGN-----------LKAAD--ETMK----AVLHSLESGKYNGYAS 149
            ..:|..:|||       |.||..           |.:.|  |.:|    |:|:..:......|..
  Fly   141 DQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGSYTD 205

  Fly   150 TQGHEIARKAVAKYSAHQRPDGEIDAN--EVVLCSGCSSALEYCILALAD-----RGQNVLVPRP 207
            :.|.|:.|:.||:|.  ::.||.|.:|  ::.|..|.|..:: .||::.:     :...|:||.|
  Fly   206 SAGLEVVRRQVAQYI--EKRDGGIASNWQDIYLTGGASPGIK-SILSMINAEVGCKAPGVMVPIP 267

  Fly   208 GFCLY-YTLAQGLDIEVRYYDLLPDQQWRADLVQLESLIDE-----NTAALLINNPSNPCGSVFD 266
            .:.|| .|:::....:|.|| |..:..|..|..:|:...||     |..||::.||.||.|.|..
  Fly   268 QYPLYSATISEYGMTKVDYY-LEEETGWSLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLT 331

  Fly   267 EKHLRELIAICERHYLPIIADEIYEHFVF-PGSKHLAVSSLTTE-------VPVLSCGGLTKRFL 323
            .:::.|:|.....:.:.::|||:|:..|: ..||..:...:..|       :.::|....:|.:|
  Fly   332 RENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPYRNLEMVSFLSTSKGYL 396

  Fly   324 VP-GWRMGWIIVHDRKNRLRDAIVGLKNMCGRILGSNTIIQGALPDILTKTPQ----SY------ 377
            .. |.|.|::.|.:...:::..:.  |::.. .|.|.|..|.|: ..|...||    ||      
  Fly   397 GECGIRGGYMEVLNLDPKVKAMLT--KSITA-ALCSTTAGQVAV-SALVNPPQPGEPSYDLYKKE 457

  Fly   378 FDGVIDVLHSNAMLAYKMLKQVRG--LDPVMPNGAMYMMIGVSIERFPEFK-------------- 426
            .||::..|...|.|.:|.|....|  ::||  .||||:        ||:.:              
  Fly   458 RDGILAALKERAELVHKALNSFEGYKVNPV--QGAMYV--------FPQIEIPPKAIEAAKAKGM 512

  Fly   427 -DDTHFVQEMVNEQSVFCLPGSCF-EYPG 453
             .|..:..|::....:..:|||.| :.||
  Fly   513 APDVFYAFELLETSGICIVPGSGFGQKPG 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 114/488 (23%)
AAT_like 112..475 CDD:99734 106/416 (25%)
CG1640NP_727696.2 PTZ00377 99..575 CDD:240391 111/461 (24%)
AAT_like 178..564 CDD:99734 98/382 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467879
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.