powered by:
Protein Alignment CG1461 and AT1G17285
DIOPT Version :9
Sequence 1: | NP_001285238.1 |
Gene: | CG1461 / 32381 |
FlyBaseID: | FBgn0030558 |
Length: | 501 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001321624.1 |
Gene: | AT1G17285 / 2745753 |
AraportID: | AT1G17285 |
Length: | 155 |
Species: | Arabidopsis thaliana |
Alignment Length: | 51 |
Identity: | 14/51 - (27%) |
Similarity: | 24/51 - (47%) |
Gaps: | 8/51 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 SGWEIKGSKLSLNTHN--RIRNIVESLKIKPNPEK------PMIPLSIGDP 119
|.:.::|..|...||: .:|::..|.::|..|.| ..||.|..:|
plant 79 SKYSVEGRSLLTMTHSSQAVRDLPVSKEMKKEPLKGENDSFRRIPRSGSNP 129
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0436 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.