DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and AT1G17285

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001321624.1 Gene:AT1G17285 / 2745753 AraportID:AT1G17285 Length:155 Species:Arabidopsis thaliana


Alignment Length:51 Identity:14/51 - (27%)
Similarity:24/51 - (47%) Gaps:8/51 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SGWEIKGSKLSLNTHN--RIRNIVESLKIKPNPEK------PMIPLSIGDP 119
            |.:.::|..|...||:  .:|::..|.::|..|.|      ..||.|..:|
plant    79 SKYSVEGRSLLTMTHSSQAVRDLPVSKEMKKEPLKGENDSFRRIPRSGSNP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 13/49 (27%)
AAT_like 112..475 CDD:99734 4/8 (50%)
AT1G17285NP_001321624.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.