DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and SPAC6B12.04c

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_593759.1 Gene:SPAC6B12.04c / 2543228 PomBaseID:SPAC6B12.04c Length:421 Species:Schizosaccharomyces pombe


Alignment Length:410 Identity:99/410 - (24%)
Similarity:172/410 - (41%) Gaps:64/410 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PMIPLSIGDPTTFGNLKAADETMKAVLHSLESGKYNGYASTQGHEIARKAVAK-YSAHQR----P 169
            |.:.||.|    |.|.......:.|...|::....|.|:.|:|....|||::: ||.:.:    |
pombe    33 PPVSLSQG----FFNYNPPKFVLDAAKKSIDEVACNQYSHTRGRPSLRKALSEAYSPYFKRTLNP 93

  Fly   170 DGEIDANEVVLCSGCSSALEYCILALADRGQNVLVPRPGFCLY---YTLAQGLDIEVRYYDLLPD 231
            |     .|:|:.:|.:........|..:.|..|:|..|.|..|   .|:..|:.:   |..::|.
pombe    94 D-----TEIVVTAGANEGFFSVFAAFLNPGDEVIVMEPFFDQYISNITMNGGVPV---YVPIIPP 150

  Fly   232 QQ----------WRADLVQLESLIDENTAALLINNPSNPCGSVFDEKHLRELIAICERHYLPIIA 286
            ::          |:.|:.:|.:.|.|.|..::||.|.||.|.:|.|:.|.|:..:..:|.|.:::
pombe   151 EEGSVKPVSAGAWKLDMNKLRNAITEKTKMIVINTPHNPLGKIFSEEELNEIADLVLKHNLLVVS 215

  Fly   287 DEIYEHFVFPGSKHLAV--SSLTTEVPVLSCGGLTKRFLVPGWRMGWIIVHDRKNRLRDAIVGLK 349
            ||:|:...|.....||.  ..|...|..:..||  |.|...|||:||:|  ..::.::.:.....
pombe   216 DEVYDRLSFVPFVRLATLRPELFKHVVTVGSGG--KTFGCTGWRVGWLI--GDESLIKYSAAAHT 276

  Fly   350 NMCGRILGSNTIIQGALPDILTKTPQ-SYFDGVIDVLHSNAMLAYKMLKQVRGLDPVMPNGAMYM 413
            .:|..:   |:..|.||.....:..: :|::...........:..|...|:. :...:|:|:.|.
pombe   277 RICFAV---NSPCQEALAIAFGEAEKHNYYEEYKSSYKKRFEILAKAFDQLE-IPYTIPDGSYYT 337

  Fly   414 MIGVSIERFPEFKDDTHFVQEMVN-------------EQSVFCLPGSCF----EYP---GYVRIV 458
            |...|..:.|:   |..|.:|:.|             |..|..:|.:.|    :.|   .|:|..
pombe   338 MANFSKLKLPK---DYPFPEEIANRPRDFKLCYWILKEIGVATIPPTEFYTDEDAPVAENYLRFA 399

  Fly   459 LTVPGAMIEEACSRIAEFCD 478
            .......:|||..|:.:..|
pombe   400 FCKTFETLEEAARRLQKLKD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 99/410 (24%)
AAT_like 112..475 CDD:99734 97/403 (24%)
SPAC6B12.04cNP_593759.1 AspB 7..421 CDD:223513 99/410 (24%)
AAT_like 35..416 CDD:99734 97/403 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.