DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and SPBC582.08

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_595176.1 Gene:SPBC582.08 / 2540891 PomBaseID:SPBC582.08 Length:505 Species:Schizosaccharomyces pombe


Alignment Length:410 Identity:96/410 - (23%)
Similarity:171/410 - (41%) Gaps:74/410 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 FGNLKAADETMKAVLHSLESGKYNGYASTQGHEIARKAVAKYSAHQRPDGEIDANEVVLCSGCSS 186
            |.||...|...::.:...|||....|:::||..:.|:.||.: ...|...:.:.:::.|.||.|.
pombe   111 FQNLFPTDVVQRSKMLLKESGSLGAYSASQGIPLVRRHVADF-IRARDGFDCEPSDIYLTSGASH 174

  Fly   187 ALEYCI-LALADRGQNVLVPRPGFCLYYTLAQGLDIEVR-----YYDLLPDQQWRADLVQLESLI 245
            |....: |.:|.....|:||.|.:.||     |..|::.     .|.|..:..|..|..|.:...
pombe   175 AARLIMTLIIARPTDGVMVPAPQYPLY-----GAQIDLMSGSMVSYSLSEENNWDIDFDQFKKSF 234

  Fly   246 DE------NTAALLINNPSNPCGSVFDEKHLRELIAICERHYLPIIADEIYEHFVFPGSKHLAVS 304
            ||      |....::.||.||.|:...|..:.:::...:...:.::|||:|::.::....|....
pombe   235 DEASKKGINVRLCVVINPGNPTGACISENSMEKVLRFAKAKGIVLLADEVYQNNIYQNKFHSFRR 299

  Fly   305 SL-----------TTEVPVLSCGGLTK-RFLVPGWRMGWIIVHDRKNRLRDAIVGLK--NMCGRI 355
            .|           ..:|.::|...::| :|...|.|.|::.|.:.....:|.|:.|.  ::|..:
pombe   300 KLGELREKEPDNHWDQVSLISVNSVSKGQFGECGQRGGYLDVVNIPEPAKDQILKLATIDICPPV 364

  Fly   356 LGSNTIIQGALPDILTKTPQ----SY--FDGVIDVLHSNAML----AYKMLKQVRGLDPVMPNGA 410
            .|.      .|.|:|...|:    ||  |...:|.:|....|    .|:..|:::.:..:.|:||
pombe   365 AGQ------LLVDMLVNPPKPGDPSYDLFIKEVDEIHEALRLQCRQLYEGTKRMKRVSCLEPHGA 423

  Fly   411 MYMMIGVSIERFPE----------FKDDTHFVQEMVNEQSVFCLPGSCFEYPG---YVRIVLTVP 462
            ||:...||:   ||          .:.|..:..|::....:..:|||.|..|.   ::||.....
pombe   424 MYLHPSVSL---PEKLITTAKAQKIQPDEFYAIELLKRSGICVVPGSGFGQPEGDYHIRITFLAK 485

  Fly   463 GAMIEEACSRIAEFCDRHYK 482
            |          .|:.:|..|
pombe   486 G----------TEYIERFVK 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 95/407 (23%)
AAT_like 112..475 CDD:99734 93/401 (23%)
SPBC582.08NP_595176.1 PTZ00377 23..504 CDD:240391 96/410 (23%)
AAT_like 116..499 CDD:99734 93/405 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.