DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and AgaP_AGAP000901

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_316880.5 Gene:AgaP_AGAP000901 / 1277418 VectorBaseID:AGAP000901 Length:552 Species:Anopheles gambiae


Alignment Length:447 Identity:107/447 - (23%)
Similarity:183/447 - (40%) Gaps:92/447 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 IRNIVESLKIKPNPEKPMIPLSIGDPTTFGNLKAADETMKAVLHSLESGKYNGYASTQGHEIARK 158
            ||.::..:...|....|.||..            |.:..:|:|...:.|....|:.:.|.|:.|:
Mosquito   139 IRQVLGLVSYPPLFNDPSIPTD------------AKQRARAILDGCKGGSVGSYSDSAGIEVIRR 191

  Fly   159 AVAKYSAHQRPDGEIDAN--EVVLCSGCSSALEYCILALA----DRGQNVLVPRPGFCLYYTLAQ 217
            ..|:|.  ||.||.|.|:  .::|.:|.|..::..:..|.    .:...|::|.|.:.||.....
Mosquito   192 HAAEYI--QRRDGGIPADWQNIILSAGASGGIKVLMALLRCPIDGKKPGVMIPIPQYPLYSATIA 254

  Fly   218 GLDIEVRYYDLLPDQQWRADLVQLESLIDE--NTAA---LLINNPSNPCGSVFDEKHLRELIAIC 277
            ..|:|...|.|....:|..|:.:||..:.|  .|:|   |::.||.||.|.|....::.::|...
Mosquito   255 EFDMEQIGYYLDEANKWGLDIAELERSLKEARKTSAPRILVVINPGNPTGQVLSRSNIEDIIKFA 319

  Fly   278 ERHYLPIIADEIYEHFVF-PGSKHLAVSSLTTEV----------PVLSCGGLTKRFLVP-GWRMG 330
            :|..|.:.|||:|:..|: .||:..:...:..|:          ..:||   :|.::.. |.|.|
Mosquito   320 QRERLVLFADEVYQDNVYESGSQFHSFKKVMMEMGEPYSKMELCSFMSC---SKGYMGECGIRGG 381

  Fly   331 WI-IVH---DRKNRLRDAIVGLKNMCGRILGSNTIIQGALPDILTKTPQ----SY--FD----GV 381
            :. ||:   |.:..|...|..  .:|....|.      |:.|.:...|:    ||  |:    .|
Mosquito   382 YAEIVNLCPDVRTMLLKCISA--QLCPTTAGQ------AVLDCVVNPPRKGEPSYEQFEKEKASV 438

  Fly   382 IDVLHSNAMLAYKMLKQVRGL--DPVMPNGAMYMMIGVSIERFPEF-----------KD----DT 429
            ::.|...|.|..:....:.|.  :||  .||||        .||:.           ||    ||
Mosquito   439 LESLRERAELVARTFNSIEGFSCNPV--QGAMY--------AFPQIRLPAKALEAAKKDGKPADT 493

  Fly   430 HFVQEMVNEQSVFCLPGSCF-EYPG--YVRIVLTVPGAMIEEACSRIAEFCDRHYKK 483
            .:..:::.|..:..:|||.| :.||  :.|..:......::|.......|.::..:|
Mosquito   494 FYAFQLLEETGICIVPGSGFGQRPGTYHFRTTILPQPEKLKEMLGLFKSFHEKFLQK 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 106/443 (24%)
AAT_like 112..475 CDD:99734 101/419 (24%)
AgaP_AGAP000901XP_316880.5 PTZ00377 79..552 CDD:240391 107/447 (24%)
AAT_like 153..537 CDD:99734 102/418 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.