DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and Gpt2

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_776291.1 Gene:Gpt2 / 108682 MGIID:1915391 Length:522 Species:Mus musculus


Alignment Length:546 Identity:117/546 - (21%)
Similarity:219/546 - (40%) Gaps:103/546 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RASCTSRSPSEPESPAP-VTPNCDVVDQALAELQLQSQDIRKQQDLVDTTATSSSSRKRSGWEIK 82
            ||:...|..|.|.:..| ...:.....:|.|.|:::.:  |..:|.:.|..:.:...|...:.::
Mouse     3 RAAVLVRRGSCPRASGPWGRSHSSAAAEASAALKVRPE--RSPRDRILTLESMNPQVKAVEYAVR 65

  Fly    83 G------SKLSLNTHNRIRNIVESLKIKPNPEKPMIPLSIGD-------PTTF----------GN 124
            |      .::.:.....|:        ||..|  :|..:|||       |.||          .|
Mouse    66 GPIVLKAGEIEMELQRGIK--------KPFTE--VIRANIGDAHAMGQQPITFLRQVMALCTYPN 120

  Fly   125 L-------KAADETMKAVLHSLESGKYNGYASTQGHEIARKAVAKYSAHQRPDG-EIDANEVVLC 181
            |       :.|.:..:.:|.:........|:::||....|:.||.:..  |.|| ..|.:.:.|.
Mouse   121 LLNSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAFIT--RRDGVPADPDNIYLT 183

  Fly   182 SGCSSALEYCILALADRG----QNVLVPRPGFCLYYTLAQGLD-IEVRYYDLLPDQQWRADLVQL 241
            :|.|..:...:..|...|    ..|::|.|.:.||..:...|| ::|.|| |..:..|..::.:|
Mouse   184 TGASDGISTILKLLVSGGGKSRTGVMIPIPQYPLYSAVISELDAVQVNYY-LDEENCWALNVDEL 247

  Fly   242 ESLIDE-----NTAALLINNPSNPCGSVFDEKHLRELIAICERHYLPIIADEIYEHFVF-PGSKH 300
            ...:.:     :...|.|.||.||.|.|...|.:.::|.......|.::|||:|:..|: |..:.
Mouse   248 RRALRQAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRF 312

  Fly   301 LAVSSL--------TTEVPVLSCGGLTKRFLVP-GWRMGWIIVHDRKNRLRDAIVGLKN--MCGR 354
            .:...:        ::.|.:.|....:|.::.. |:|.|::.|.:....::..:|.|.:  :|..
Mouse   313 HSFKKVLYQMGHEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPP 377

  Fly   355 ILGSNTIIQGALPDILTKTPQSYFDG----------VIDVLHSNAMLAYKMLKQVRGLDPVMPNG 409
            :.|     |.|: ||:...|:...:.          |:..|...|.|...:..||.|:......|
Mouse   378 VSG-----QAAM-DIVVNPPEPGEESFEQFSREKEFVLGNLAKKAKLTEDLFNQVPGIQCNPLQG 436

  Fly   410 AMY-----MMIGVSIERFPEFK--DDTHFVQEMVNEQSVFCLPGSCF---EYPGYVRIVLTVPGA 464
            |||     ::...::|.....|  .|..:..:::.|..:..:|||.|   |...:.|:.:..|..
Mouse   437 AMYAFPRILIPAKAVEAAQSHKMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVD 501

  Fly   465 MIEEACSRIAEFCDRHYKKESRNFIE 490
            .::....::.:|   |.|     |:|
Mouse   502 KLKTVLHKVKDF---HLK-----FLE 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 100/474 (21%)
AAT_like 112..475 CDD:99734 94/429 (22%)
Gpt2NP_776291.1 PTZ00377 48..522 CDD:240391 106/499 (21%)
AAT_like 123..512 CDD:99734 85/397 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.