DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and LOC103911241

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_021326762.1 Gene:LOC103911241 / 103911241 -ID:- Length:311 Species:Danio rerio


Alignment Length:304 Identity:77/304 - (25%)
Similarity:127/304 - (41%) Gaps:59/304 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 ALADRGQNVLVPRPGFCLYYTL-----AQGLDIEVRYYDLL----PDQQWRADLVQLESLIDENT 249
            ||.:....|::..|.|..|..:     |:.:.|.:|.....    ....|..|..:|.|..:..|
Zfish     3 ALVEEEDEVVIIEPFFDTYVPMVKMAGAKPVLIPLRLKSTATIGRSSADWVLDQEELASKFNSKT 67

  Fly   250 AALLINNPSNPCGSVFDEKHLRELIAICERHYLPIIADEIYEHFVFPGSKHLAVSSLTTEVP--- 311
            .|::||.|:||.|.||....|:.:..:|.:|.....:||:||..::.|.:|:.:::|    |   
Zfish    68 KAIIINTPNNPIGKVFSRSELQAIADLCIKHDTLCFSDEVYEWLIYKGHEHVKIATL----PGMW 128

  Fly   312 --VLSCGGLTKRFLVPGWRMGW------IIVHDR---KNRLRDAIVGLKNMCGRILGSNTIIQGA 365
              .::.|...|.|.|.||::||      :|.|.:   :|.|......|:...|         ||.
Zfish   129 DRTITIGSAGKTFSVTGWKLGWSIGPEHLIKHLQTVMQNSLYTCPTPLQEAVG---------QGL 184

  Fly   366 LPDI-LTKTPQSYFDGVIDVLHSNAMLAYKMLKQVRGLDPVMPNGAMYMMIGVSIERFPEFKDDT 429
            |.|. |...|..||..:...|.........:|.|. |:.||:|.|..::|..|:...    :|.|
Zfish   185 LRDFELMGQPGCYFSSLALELEGKRDRMAAILAQT-GMTPVVPEGGYFIMADVTALN----QDLT 244

  Fly   430 H----------FVQEMVNEQSVFCLPGSCF-------EYPGYVR 456
            |          ||:.|:.|:.:..:|.:.|       ::..|:|
Zfish   245 HMGDDEPYDYKFVKWMIKEKKLAAIPVTAFVGEDSVKQFERYIR 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 77/304 (25%)
AAT_like 112..475 CDD:99734 77/304 (25%)
LOC103911241XP_021326762.1 Aminotran_1_2 <16..311 CDD:332562 74/291 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.