DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and si:ch211-217a12.1

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_001919896.1 Gene:si:ch211-217a12.1 / 100148522 ZFINID:ZDB-GENE-121214-95 Length:488 Species:Danio rerio


Alignment Length:463 Identity:113/463 - (24%)
Similarity:190/463 - (41%) Gaps:106/463 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 TTATSSSSRKRSGWEIKGSKLSLNTHNRIRNIVESLKI---KPNPEKPMIPLSIGD-------PT 120
            |..|.:.:.||..:.::|..:     .|...|.:.||:   ||..|  :|..:|||       |.
Zfish    14 TVDTMNPNIKRLEYAVRGPIV-----QRAVQIDKELKMGIKKPFTE--VIKANIGDCHAMGQKPI 71

  Fly   121 TF---------------GNLKAADETMKA--VLHSLESGKYNGYASTQGHEIARKAVAKYSAHQR 168
            ||               .|....|...:|  :|.:...|....|:::||.|:.|:.||:|.  :|
Zfish    72 TFFRQVLALCSYPDLLEDNKFPEDAKSRAQRILKACGGGSLGAYSTSQGIEMIRQDVARYI--ER 134

  Fly   169 PDGEI--DANEVVLCSGCSSALEYCILALADRGQ-----NVLVPRPGFCLY-YTLAQGLDIEVRY 225
            .||.|  |.:.:.|.:|.|.|: ..:|.|...|:     .|::..|.:.|| ..||:...:::.|
Zfish   135 RDGGIACDPDNIYLSTGASDAI-VTMLKLMVSGEGASRTGVMISIPQYPLYSAALAELGAVQINY 198

  Fly   226 YDLLPDQQWRADLVQLESLIDE-----NTAALLINNPSNPCGSVFDEKHLRELIAICERHYLPII 285
            | |..|..|..|:.:|...:.|     ...||.|.||.||.|.|...:.:.|:|.......|.::
Zfish   199 Y-LDEDNCWSLDINELRRALQEAKKHCRPRALCIINPGNPTGQVQSRQCIEEVIRFAADENLFLM 262

  Fly   286 ADEIYEHFVF-PGSKHLAVSSL--------TTEVPVLSCGGLTKRFLVP-GWRMGWIIVHDRKNR 340
            :||:|:..|: .|.|..:...:        :::|.:.|....:|.::.. |:|.|::.|.:....
Zfish   263 SDEVYQDNVYADGCKFHSFKKVLFEMGPQYSSKVELASFHSTSKCYMGECGFRGGYMEVVNLDPE 327

  Fly   341 LRDAIVGLKN--MCGRILGSNTIIQGALPDILTKTPQ----SY------FDGVIDVLHSNAMLAY 393
            ::..:..|.:  :|..:.|.      ||.|::...||    ||      ....:..|...|.:..
Zfish   328 VKVQLTKLVSVRLCPPVPGQ------ALLDVVVNPPQPDEPSYDTFIKERSDTLAALAEKASMTQ 386

  Fly   394 KMLKQVRGL--DPVMPNGAMYMMIGVSIERFPEF---------------KDDTHFVQEMVNEQSV 441
            .:|.||.|:  :||  .||||        .||..               ..|..:..:::.|..:
Zfish   387 DILNQVPGIKCNPV--QGAMY--------TFPRIHLPPKAILKAKENGQSPDMFYCMKLLEETGI 441

  Fly   442 FCLPGSCF 449
            ..:|||.|
Zfish   442 CLVPGSGF 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 109/450 (24%)
AAT_like 112..475 CDD:99734 101/414 (24%)
si:ch211-217a12.1XP_001919896.1 PTZ00377 9..488 CDD:240391 113/463 (24%)
AAT_like 93..478 CDD:99734 93/377 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.