DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXD12 and slou

DIOPT Version :10

Sequence 1:NP_067016.3 Gene:HOXD12 / 3238 HGNCID:5135 Length:270 Species:Homo sapiens
Sequence 2:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster


Alignment Length:71 Identity:28/71 - (39%)
Similarity:43/71 - (60%) Gaps:2/71 - (2%)


- Green bases have known domain annotations that are detailed below.


Human   191 DGLPWGAAPG--RARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNR 253
            ||...|...|  :.|:.|..:|.:|:..|||:|....:::..:|..|:..|:|::.|||||||||
  Fly   532 DGKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNR 596

Human   254 RMKKKR 259
            |.|.|:
  Fly   597 RTKWKK 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXD12NP_067016.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..122
Homeodomain 203..259 CDD:459649 23/55 (42%)
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.