DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXD12 and bcd

DIOPT Version :10

Sequence 1:NP_067016.3 Gene:HOXD12 / 3238 HGNCID:5135 Length:270 Species:Homo sapiens
Sequence 2:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster


Alignment Length:106 Identity:36/106 - (33%)
Similarity:49/106 - (46%) Gaps:21/106 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   164 DDTKGPLNLNMTVQAAGVASCLRPSLP-----------DGLPWGAAPGRARKKRKPYTKQQIAEL 217
            |:..|.:|.|.          :||.||           :.||......|.|:.|..:|..|||||
  Fly    58 DERTGAINYNY----------IRPYLPNQMPKPDVFPSEELPDSLVMRRPRRTRTTFTSSQIAEL 112

Human   218 ENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKK 258
            |..||...::...:..:||.:|.|...||||||:|||.:.|
  Fly   113 EQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXD12NP_067016.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..122
Homeodomain 203..259 CDD:459649 25/56 (45%)
bcdNP_788587.1 Homeodomain 106..153 CDD:459649 21/46 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.