DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXD12 and zen2

DIOPT Version :10

Sequence 1:NP_067016.3 Gene:HOXD12 / 3238 HGNCID:5135 Length:270 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:96 Identity:34/96 - (35%)
Similarity:58/96 - (60%) Gaps:12/96 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   172 LNMTVQAAGVASCLRPSLPDGLPWGAAPGRARKKRKPYTKQQIAELENEFLVNEFINRQKRKELS 236
            :.:.|:||..|:.            .:..::::.|..::..|:.|||.||.:|:::.|.:|.|:|
  Fly    25 VELNVEAAPTATT------------RSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEIS 77

Human   237 NRLNLSDQQVKIWFQNRRMKKKRVVLREQAL 267
            .||.|:::||||||||||||.|:...|:.|:
  Fly    78 QRLALTERQVKIWFQNRRMKLKKSTNRKGAI 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXD12NP_067016.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..122
Homeodomain 203..259 CDD:459649 27/55 (49%)
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.