DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRNA-cap and dusp11

DIOPT Version :9

Sequence 1:NP_572952.1 Gene:mRNA-cap / 32379 FlyBaseID:FBgn0030556 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001315299.1 Gene:dusp11 / 550417 ZFINID:ZDB-GENE-050417-226 Length:328 Species:Danio rerio


Alignment Length:189 Identity:61/189 - (32%)
Similarity:95/189 - (50%) Gaps:8/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LPNRWLYCPRKSDTIIAERFLAFKTPLSNNFHDKMPIECTFQPEMLFEYCKTLKVKLGLWVDLTN 79
            :|:||.........|...||:|||.||..:|...:.....|.|..|....:..:.:|||.:|||.
Zfish     9 VPDRWTDYTSLGKRIPGTRFIAFKVPLKQSFRRHLSESEVFGPFDLVRLLEKERQQLGLIIDLTF 73

  Fly    80 TKRFYDRSAVEEL--GAKYIKLQCRGHGETPSPEQTHSFIEIVDNFINERPFD--VIAVHCTHGF 140
            |.|:|   ..|:|  ...|:|:...|| |.|:.....||.:.|.:|:::...:  :|.||||||.
Zfish    74 TTRYY---RAEDLPDTLYYMKIFTAGH-EVPNDATILSFKKAVRHFLHDNASNDKLIGVHCTHGL 134

  Fly   141 NRTGFLIVCYLVERLDCSVSAALAIFASARPPGIYKQDYINELYKRYEDTNAAPAAPEQ 199
            ||||:||..||::........|:.:|..:|...|.:|:|:.:|....:.:|.....|:|
Zfish   135 NRTGYLICRYLIDVDGMMPQKAINLFNESRGHSIERQNYLQDLTTGPKRSNNGMDEPDQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRNA-capNP_572952.1 PTPc <116..171 CDD:304379 20/56 (36%)
mRNA_cap_enzyme 307..497 CDD:279649
mRNA_cap_C 502..597 CDD:281856
dusp11NP_001315299.1 PTPc 49..174 CDD:304379 44/128 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5226
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544021at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.