DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRNA-cap and pir-1

DIOPT Version :9

Sequence 1:NP_572952.1 Gene:mRNA-cap / 32379 FlyBaseID:FBgn0030556 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_495959.2 Gene:pir-1 / 174460 WormBaseID:WBGene00011967 Length:233 Species:Caenorhabditis elegans


Alignment Length:229 Identity:75/229 - (32%)
Similarity:112/229 - (48%) Gaps:27/229 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RDRERGSGP-LPNRWLYCPRKSDTIIAERFLAFKTPLSNNFHD--KMPIECTFQPEMLFEYCKTL 67
            |..||..|. ||:||.........|...||:.|||||.::|.|  .||:|..|..:.|....:..
 Worm    15 RGYERLPGKRLPDRWNIYDNVGRDIDGTRFVPFKTPLDSSFFDGKNMPVELQFGVKTLISLAQQA 79

  Fly    68 KVKLGLWVDLTNTKRFYDRSAVEELGAKYIKLQCRGHGETPSPEQTHSFIEIVDNFINERPFD-- 130
            ..::||.:|||||.|:|.::...:.|.||:||.|.||......:....||..|..|:|::..|  
 Worm    80 NKQIGLVIDLTNTDRYYKKTEWADHGVKYLKLNCPGHEVNEREDLVQDFINAVKEFVNDKENDGK 144

  Fly   131 VIAVHCTHGFNRTGFLIVCYLVERLDCSVSAALAIFASARPPGIYKQDYINELY-----KRYEDT 190
            :|.||||||.||||:||..|:::..:.|.|.|:::|...|...:.::.|...||     |:|..:
 Worm   145 LIGVHCTHGLNRTGYLICRYMIDVDNYSASDAISMFEYYRGHPMEREHYKKSLYEAERKKKYGKS 209

  Fly   191 NAAPAAPEQPNWCLDYDDGNGDGFVQDNSSSTSQ 224
            :                 |...|...|::.|:.|
 Worm   210 S-----------------GKSSGNSADSTISSEQ 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRNA-capNP_572952.1 PTPc <116..171 CDD:304379 24/56 (43%)
mRNA_cap_enzyme 307..497 CDD:279649
mRNA_cap_C 502..597 CDD:281856
pir-1NP_495959.2 DSPc 65..201 CDD:307089 47/135 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544021at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.