DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRNA-cap and dusp11

DIOPT Version :9

Sequence 1:NP_572952.1 Gene:mRNA-cap / 32379 FlyBaseID:FBgn0030556 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_012814069.2 Gene:dusp11 / 100151717 XenbaseID:XB-GENE-982578 Length:367 Species:Xenopus tropicalis


Alignment Length:220 Identity:67/220 - (30%)
Similarity:99/220 - (45%) Gaps:35/220 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LPNRWL-YCPRKSDTIIAERFLAFKTPLSNNFHDKMPIECTFQPEMLFEYCKTLKVKLGLWVDLT 78
            ||:||. |.| ....|...||:|||.||...|:.::.....|....|....:....:||:.:|||
 Frog    32 LPDRWTDYVP-LGKRIPGTRFIAFKVPLKKIFNSRIEAWQRFSSADLIRDIQAQDEELGIIIDLT 95

  Fly    79 NTKRFYDRSAVEELGAKYIKLQCRGHGETPSPEQTHSFIEIVDNFINERPFD--VIAVHCTHGFN 141
            .|.|:|....:.| ...|.|:...|| |.||.|....|..||:.|:.|...:  :|.||||||.|
 Frog    96 CTTRYYSPEELPE-SLNYAKIFTVGH-EVPSDETIFQFKCIVNQFMKENSNNDKLIGVHCTHGLN 158

  Fly   142 RTGFLIVCYLVERLDCSVSAALAIFASARPPGIYKQDYINELYKRYEDTNA-------------- 192
            |||:|:..||::.|....:.|:..|..:|...|.:::|:::|....:.:||              
 Frog   159 RTGYLVCRYLIDVLGMVPAEAIEKFNQSRGHCIERKNYLDDLMYGVQRSNAEIDKAPVPLHKYKQ 223

  Fly   193 ---------------APAAPEQPNW 202
                           .|..||||.:
 Frog   224 KIPNVNNPSVPPCLPPPPRPEQPRF 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRNA-capNP_572952.1 PTPc <116..171 CDD:304379 22/56 (39%)
mRNA_cap_enzyme 307..497 CDD:279649
mRNA_cap_C 502..597 CDD:281856
dusp11XP_012814069.2 DSP_DUSP11 35..200 CDD:350503 57/167 (34%)
PRK10263 <257..>359 CDD:236669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544021at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.