DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and AT1G80630

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_565242.1 Gene:AT1G80630 / 844402 AraportID:AT1G80630 Length:578 Species:Arabidopsis thaliana


Alignment Length:361 Identity:88/361 - (24%)
Similarity:148/361 - (40%) Gaps:69/361 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 EFINNDLSQFLADN-------CVDGEAAAPQICLTDLPFEILLRILSYLDLKSLFRVGHVSRTFY 357
            :||::|..:|:..|       .::|....|:..|....| :..|.|:.|||...|          
plant   200 DFISSDCIKFVLRNSRNLESLAINGIGLRPRESLLTDAF-LFARCLTELDLSDSF---------- 253

  Fly   358 DISRHPLLYAEISLKPYWDVASSELLCTLARRATMLRKLDLSWCGGF---GNVSPTEFKKFLTQR 419
                                .|.:|||.:|.....|:||.||.|.||   |.:       :|..:
plant   254 --------------------LSDDLLCLIASAKLPLKKLLLSDCHGFTFDGIL-------YLLDK 291

  Fly   420 GDNLTHLRLNSCKFLNASCIENVGIVCDNLIELSLRNCATEPPLLNFSCLANLKNLERLDLFQTY 484
            ..:|.||.|....||:...:..:|:....|..|:|..|:....|..||.:....:|..:.:..|.
plant   292 YQSLVHLNLKGANFLSDEMVMKLGMFFRRLTFLNLSFCSKLTGLAFFSIIERCVSLRCMIMVGTN 356

  Fly   485 FETELLLSMLEGNRKLKHL--NLAFCGVSVN---MDNVAAHLATYNTQLISLDLWKAHFLSSRGL 544
            |..|      |..:..|..  .:.|..:|.|   :|.....::.:...:.|||:.:...::..|:
plant   357 FGVE------EYTKDTKDFKSGVKFLYLSRNHNLLDECLEKISRHCPFIESLDVAQCPGITRDGI 415

  Fly   545 QSLAR-LHQLEELDLGWCMREASLGDGLFQLLSNCPKLKKLFLSAVRGT--TERDLMHIAALGKN 606
            ..:.| ..:|..||:..|....|||...|:|    |||:.|   ...||  .:..|..|:...:.
plant   416 LEVWRNCGKLRSLDISRCTGIKSLGVVDFEL----PKLESL---RACGTWIDDEALDMISKKCRG 473

  Fly   607 LEQLDLMGILNITHERVYDILVNCPKLQLLDLSFCD 642
            |..|||.|.||::...|.:::.:|.:|:.::|.:|:
plant   474 LLHLDLQGCLNVSSRGVKEVVQSCIRLREINLKYCE 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 8/45 (18%)
leucine-rich repeat 393..422 CDD:275381 10/31 (32%)
leucine-rich repeat 423..442 CDD:275381 6/18 (33%)
LRR_RI 437..>641 CDD:238064 51/211 (24%)
leucine-rich repeat 449..474 CDD:275381 7/24 (29%)
leucine-rich repeat 475..499 CDD:275381 5/23 (22%)
leucine-rich repeat 500..527 CDD:275381 5/31 (16%)
leucine-rich repeat 528..552 CDD:275381 5/24 (21%)
AMN1 552..>660 CDD:187754 29/93 (31%)
leucine-rich repeat 553..580 CDD:275381 9/26 (35%)
leucine-rich repeat 581..606 CDD:275381 6/26 (23%)
leucine-rich repeat 607..632 CDD:275381 9/24 (38%)
leucine-rich repeat 633..652 CDD:275381 3/10 (30%)
AT1G80630NP_565242.1 leucine-rich repeat 64..108 CDD:275381
leucine-rich repeat 109..134 CDD:275381
AMN1 121..335 CDD:187754 41/172 (24%)
leucine-rich repeat 135..159 CDD:275381
leucine-rich repeat 165..190 CDD:275381
leucine-rich repeat 191..216 CDD:275381 5/15 (33%)
leucine-rich repeat 244..268 CDD:275381 10/53 (19%)
leucine-rich repeat 269..294 CDD:275381 10/31 (32%)
leucine-rich repeat 295..320 CDD:275381 7/24 (29%)
leucine-rich repeat 321..346 CDD:275381 7/24 (29%)
leucine-rich repeat 347..398 CDD:275381 10/56 (18%)
AMN1 <386..508 CDD:187754 34/128 (27%)
leucine-rich repeat 399..424 CDD:275381 5/24 (21%)
leucine-rich repeat 425..448 CDD:275381 9/26 (35%)
leucine-rich repeat 449..473 CDD:275381 6/26 (23%)
leucine-rich repeat 474..499 CDD:275381 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003673
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.