DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and AT1G80570

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_974191.1 Gene:AT1G80570 / 844396 AraportID:AT1G80570 Length:480 Species:Arabidopsis thaliana


Alignment Length:327 Identity:81/327 - (24%)
Similarity:128/327 - (39%) Gaps:73/327 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 VASSELLCTLARRATMLRKLDL---SWCGGFGNVSPTEFKKFLTQRGDNLTHLRLNSCKFLNASC 438
            |.:|:.|.:|.||...|.|:::   .|....|.....:....||....:||.|.|:.|.|     
plant    63 VPASDALLSLCRRFPNLSKVEIIYSGWMSKLGKQVDDQGLLVLTTNCHSLTDLTLSFCTF----- 122

  Fly   439 IENVGI----VCDNLIELSLR------NCATEPPLLNFSCLANLKNLERLDLFQ----------T 483
            |.:|||    .|..|..|.|.      .|..      .|.....|.|.||.|.:          .
plant   123 ITDVGIGHLSSCPELSSLKLNFAPRITGCGV------LSLAVGCKKLRRLHLIRCLNVASVEWLE 181

  Fly   484 YF---ET--ELLL----SMLEGNR-KLKHLNLAFCGVSVNMDNVAAHLATYNTQLISLDLWKAHF 538
            ||   ||  ||.:    ::.||:. ||::.......:...:|....::..|:.  :.::.|.   
plant   182 YFGKLETLEELCIKNCRAIGEGDLIKLRNSWRKLTSLQFEVDANYRYMKVYDQ--LDVERWP--- 241

  Fly   539 LSSRGLQSLARLHQLEELDLGWCMREASLGDGLFQLLSNCPKLKKLFLSAVRGTTERDLMHIAAL 603
                  :.|.....|.||.||.|:  .:.|.||..:|.||..|:||.|....|.::.|::.:...
plant   242 ------KQLVPCDSLVELSLGNCI--IAPGRGLACVLRNCKNLEKLHLDMCTGVSDSDIIALVQK 298

  Fly   604 GKNLEQLDL-------MGILN-----ITHERVYDILVNCPKLQLLDLSFCDNIMDRDFDLLAEWS 656
            ..:|..:.|       :.:||     :|.|.:..|..:|.||:...:||.|.    :|..|..::
plant   299 ASHLRSISLRVPSDFTLPLLNNITLRLTDESLSAIAQHCSKLESFKISFSDG----EFPSLFSFT 359

  Fly   657 RQ 658
            .|
plant   360 LQ 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689
leucine-rich repeat 393..422 CDD:275381 6/31 (19%)
leucine-rich repeat 423..442 CDD:275381 7/18 (39%)
LRR_RI 437..>641 CDD:238064 58/245 (24%)
leucine-rich repeat 449..474 CDD:275381 5/30 (17%)
leucine-rich repeat 475..499 CDD:275381 12/43 (28%)
leucine-rich repeat 500..527 CDD:275381 3/26 (12%)
leucine-rich repeat 528..552 CDD:275381 2/23 (9%)
AMN1 552..>660 CDD:187754 34/119 (29%)
leucine-rich repeat 553..580 CDD:275381 12/26 (46%)
leucine-rich repeat 581..606 CDD:275381 6/24 (25%)
leucine-rich repeat 607..632 CDD:275381 8/36 (22%)
leucine-rich repeat 633..652 CDD:275381 5/18 (28%)
AT1G80570NP_974191.1 AMN1 77..309 CDD:187754 61/255 (24%)
leucine-rich repeat 79..111 CDD:275381 6/31 (19%)
leucine-rich repeat 112..136 CDD:275381 11/28 (39%)
leucine-rich repeat 137..162 CDD:275381 5/30 (17%)
leucine-rich repeat 163..188 CDD:275381 6/24 (25%)
leucine-rich repeat 189..226 CDD:275381 7/36 (19%)
AMN1 241..435 CDD:187754 35/136 (26%)
leucine-rich repeat 250..275 CDD:275381 12/26 (46%)
leucine-rich repeat 276..301 CDD:275381 6/24 (25%)
leucine-rich repeat 302..339 CDD:275381 8/36 (22%)
leucine-rich repeat 340..368 CDD:275381 7/26 (27%)
leucine-rich repeat 372..396 CDD:275381
leucine-rich repeat 397..421 CDD:275381
leucine-rich repeat 422..446 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.