DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and EBF2

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_197917.1 Gene:EBF2 / 832607 AraportID:AT5G25350 Length:623 Species:Arabidopsis thaliana


Alignment Length:344 Identity:88/344 - (25%)
Similarity:139/344 - (40%) Gaps:90/344 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 WDV-ASSEL-LCTLARRATMLRKLDLSWCGGF---GNVSPTEFKKFLTQRGDNLTHLRLNSCKFL 434
            |:: |.|:| |..:||...|:.|||||.|.|.   |.|:       :.:...||:.|.::||..:
plant   175 WNLPAVSDLGLSEIARSCPMIEKLDLSRCPGITDSGLVA-------IAENCVNLSDLTIDSCSGV 232

  Fly   435 NASCIENVGIVCDNLIELSLRNC--------------------ATEPPLLNFSCLANLKNLERLD 479
            ....:..:...|.||..:|:|:|                    ..:..:||.|.|:       |.
plant   233 GNEGLRAIARRCVNLRSISIRSCPRIGDQGVAFLLAQAGSYLTKVKLQMLNVSGLS-------LA 290

  Fly   480 LFQTY--FETELLLSMLE--------------GNRKLKHLNLAFCGVSVNMDNVAAHLATYNTQL 528
            :...|  ..|:|:|..|:              |.:|||.|::..|....::...|......:.:.
plant   291 VIGHYGAAVTDLVLHGLQGVNEKGFWVMGNAKGLKKLKSLSVMSCRGMTDVGLEAVGNGCPDLKH 355

  Fly   529 ISLDLWKAHFLSSRGLQSLAR-LHQLEELDLGWCMREASLGDGLFQLLSNC-PKLKKLFLSAVRG 591
            :||:  |...:|.:||.:||: ...||.|.|..|.|....  ||...|.|| .|||...|:...|
plant   356 VSLN--KCLLVSGKGLVALAKSALSLESLKLEECHRINQF--GLMGFLMNCGSKLKAFSLANCLG 416

  Fly   592 TTE---------------RDL----------MHIAALGK---NLEQLDLMGILNITHERVYDIL- 627
            .::               |.|          ..:|.|||   .|:.::|.|:..:|...|.::| 
plant   417 ISDFNSESSLPSPSCSSLRSLSIRCCPGFGDASLAFLGKFCHQLQDVELCGLNGVTDAGVRELLQ 481

  Fly   628 VNCPKLQLLDLSFCDNIMD 646
            .|...|..::||.|.|:.|
plant   482 SNNVGLVKVNLSECINVSD 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689
leucine-rich repeat 393..422 CDD:275381 9/31 (29%)
leucine-rich repeat 423..442 CDD:275381 4/18 (22%)
LRR_RI 437..>641 CDD:238064 63/270 (23%)
leucine-rich repeat 449..474 CDD:275381 8/44 (18%)
leucine-rich repeat 475..499 CDD:275381 7/39 (18%)
leucine-rich repeat 500..527 CDD:275381 5/26 (19%)
leucine-rich repeat 528..552 CDD:275381 8/24 (33%)
AMN1 552..>660 CDD:187754 35/125 (28%)
leucine-rich repeat 553..580 CDD:275381 11/27 (41%)
leucine-rich repeat 581..606 CDD:275381 10/52 (19%)
leucine-rich repeat 607..632 CDD:275381 7/25 (28%)
leucine-rich repeat 633..652 CDD:275381 6/14 (43%)
EBF2NP_197917.1 F-box 54..>92 CDD:279040
AMN1 <138..268 CDD:187754 28/99 (28%)
leucine-rich repeat 169..194 CDD:275381 7/18 (39%)
leucine-rich repeat 195..220 CDD:275381 9/31 (29%)
leucine-rich repeat 221..246 CDD:275381 5/24 (21%)
leucine-rich repeat 247..278 CDD:275381 4/30 (13%)
leucine-rich repeat 279..326 CDD:275381 11/53 (21%)
leucine-rich repeat 327..352 CDD:275381 5/24 (21%)
leucine-rich repeat 353..378 CDD:275381 8/26 (31%)
leucine-rich repeat 379..402 CDD:275381 9/24 (38%)
leucine-rich repeat 406..459 CDD:275381 10/52 (19%)
leucine-rich repeat 407..433 CDD:275381 3/25 (12%)
AMN1 435..>582 CDD:187754 19/66 (29%)
leucine-rich repeat 460..511 CDD:275381 13/41 (32%)
leucine-rich repeat 487..512 CDD:275381 6/14 (43%)
leucine-rich repeat 514..537 CDD:275381
leucine-rich repeat 540..566 CDD:275381
leucine-rich repeat 567..595 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.