DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and VFB3

DIOPT Version :10

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_567316.1 Gene:VFB3 / 826171 AraportID:AT4G07400 Length:554 Species:Arabidopsis thaliana


Alignment Length:473 Identity:103/473 - (21%)
Similarity:170/473 - (35%) Gaps:153/473 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 DAIGSTSGDGSGGSISHKLR----TLKFQ-----------PNCGE--DGATKLHEFINNDLSQFL 310
            |.:..|.|........|:.|    |.||:           ||..|  .||.:.:::|:|     |
plant    18 DNLSKTRGSRREHCEPHRRRMGQSTSKFRRSKTTFTSPVLPNLREQNSGADEPYDYISN-----L 77

  Fly   311 ADNCVDGEAAAPQICLTDLPFEILLRILSYLDLKSLFRVGHVSRTFYDIS---RHPLLYAEISLK 372
            .|.|:                .::.:.|:..|||   |...|.|.:..|.   ||     .:|||
plant    78 PDECL----------------SLIFQSLTCADLK---RCSLVCRRWLTIEGQCRH-----RLSLK 118

  Fly   373 PYWDVASSELLCTLARRATMLRKLDLSWCGGFGNVSPTEFKKF-----LTQRGD----------- 421
                 |.|:|:                      :|.|:.|.:|     |..|.|           
plant   119 -----AQSDLI----------------------SVIPSLFTRFDSVTKLVLRSDRRSLGICDNAF 156

  Fly   422 --------NLTHLRLNSCKFLNASCIENVGIV-----CDNLIELSLRNCA----TEPPLLNFSCL 469
                    |||.|:|..|..     |.::||:     |.:|.::|..:|.    ....||| :||
plant   157 VMISVRCRNLTRLKLRGCPE-----ISDLGIIGFTENCRSLKKVSFGSCGFGVKGMNALLN-TCL 215

  Fly   470 A----NLKNLE------------------RLDLFQTYFETELLLSMLEGNRKLKHLNLAFCGVSV 512
            .    ::|.|.                  ::...:.....:....:|.|.:.|:.|.:..|  |.
plant   216 GLEELSVKRLRGIGAGAELIGPGGAAGSLKVICLKELHNGQCFAPLLSGAKGLRILKIFRC--SG 278

  Fly   513 NMDNVAAHLATYNTQLISLDLWKAHFLSSRGLQSLARLHQLEELDLGWCMREASLGD----GLFQ 573
            :.|.|...:......::.:.|.:.. :|..||.:|::...:|.|.|      ....|    ||..
plant   279 DWDRVFEAVRDKVNAIVEIHLERIQ-MSDLGLTALSKCSGVEVLHL------VKTPDCTNVGLAL 336

  Fly   574 LLSNCPKLKKLFLSAVRGTT--ERDLMHIAALGKNLEQLDLMGILNITHERVYDILVNCPKLQLL 636
            :...|..|:||.:...:...  :..|:.:|....||::|.|:|: |.|...:..|:.||..|:.|
plant   337 VAERCKLLRKLHIDGWKTNRIGDEGLIVVAKYCWNLQELVLIGV-NPTKLSLEAIVSNCLNLERL 400

  Fly   637 DLSFCDNIMDRDFDLLAE 654
            .|...|.:.|.:...:||
plant   401 ALCGSDTVGDTELCCIAE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..370 CDD:463757 10/46 (22%)
leucine-rich repeat 393..422 CDD:275381 7/52 (13%)
leucine-rich repeat 423..442 CDD:275381 6/18 (33%)
LRR <427..>639 CDD:443914 53/248 (21%)
leucine-rich repeat 449..474 CDD:275381 8/32 (25%)
leucine-rich repeat 475..499 CDD:275381 3/41 (7%)
leucine-rich repeat 500..527 CDD:275381 6/26 (23%)
leucine-rich repeat 528..552 CDD:275381 5/23 (22%)
leucine-rich repeat 553..580 CDD:275381 7/30 (23%)
leucine-rich repeat 581..606 CDD:275381 5/26 (19%)
leucine-rich repeat 607..632 CDD:275381 9/24 (38%)
leucine-rich repeat 633..652 CDD:275381 5/18 (28%)
VFB3NP_567316.1 F-box_AtTIR1-like 74..112 CDD:438930 13/61 (21%)
leucine-rich repeat 89..114 CDD:275381 10/32 (31%)
leucine-rich repeat 115..165 CDD:275381 13/76 (17%)
AMN1 <146..>226 CDD:187754 19/85 (22%)
leucine-rich repeat 166..191 CDD:275381 9/29 (31%)
leucine-rich repeat 192..216 CDD:275381 7/24 (29%)
leucine-rich repeat 268..293 CDD:275381 6/26 (23%)
leucine-rich repeat 294..317 CDD:275381 5/23 (22%)
leucine-rich repeat 318..343 CDD:275381 7/30 (23%)
AMN1 <340..>463 CDD:187754 23/80 (29%)
leucine-rich repeat 344..371 CDD:275381 5/26 (19%)
leucine-rich repeat 372..396 CDD:275381 9/24 (38%)
leucine-rich repeat 397..422 CDD:275381 7/22 (32%)
leucine-rich repeat 423..447 CDD:275381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.