DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and AT4G03630

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_192272.1 Gene:AT4G03630 / 825663 AraportID:AT4G03630 Length:220 Species:Arabidopsis thaliana


Alignment Length:207 Identity:58/207 - (28%)
Similarity:90/207 - (43%) Gaps:41/207 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   488 ELLLSMLEGNRKLKHLNLAFCG---------VSVNM-----DNVAAHLATYNTQLISLDLWKAHF 538
            |||..:...:..||.|....|.         |.:|:     |::..::|..::.|..|.|.|...
plant    10 ELLTFVAYRSSILKRLGRMMCHAVALSQGGCVEINIEHFGTDSLLTYIADRSSNLRHLGLAKCDQ 74

  Fly   539 LSSRGLQSLA-RLHQLEELDLGWCMREASLGDGLFQLLSNCPKLKKLFLSAVRG------TTERD 596
            ::..||.:.| :|..||:|:|.:|:.:   |..|..:...|..||.|.|:. :|      |.:.|
plant    75 ITGMGLFTEAMKLPLLEDLELSYCLIK---GKNLEAIGFACLHLKTLKLNC-QGFKFPGFTYDHD 135

  Fly   597 LMHIAALGKNLEQLDLMGILNITHERVYDILVN-----CPKLQLLDLSFCDNIMDRDFDLLAEWS 656
            .:.||.....|..|.|.|      .||.|:.:|     ||.|:.|||..|.||     :|:.:..
plant   136 ALGIAKRMPELRCLQLFG------NRVSDVGLNAIFDGCPHLEHLDLRQCFNI-----NLVGDLE 189

  Fly   657 RQFKVDIKSSRR 668
            ::....||..||
plant   190 KRCMERIKDLRR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689
leucine-rich repeat 393..422 CDD:275381
leucine-rich repeat 423..442 CDD:275381
LRR_RI 437..>641 CDD:238064 50/178 (28%)
leucine-rich repeat 449..474 CDD:275381
leucine-rich repeat 475..499 CDD:275381 3/10 (30%)
leucine-rich repeat 500..527 CDD:275381 8/40 (20%)
leucine-rich repeat 528..552 CDD:275381 8/24 (33%)
AMN1 552..>660 CDD:187754 35/118 (30%)
leucine-rich repeat 553..580 CDD:275381 8/26 (31%)
leucine-rich repeat 581..606 CDD:275381 9/30 (30%)
leucine-rich repeat 607..632 CDD:275381 9/29 (31%)
leucine-rich repeat 633..652 CDD:275381 7/18 (39%)
AT4G03630NP_192272.1 AMN1 <39..179 CDD:187754 43/149 (29%)
leucine-rich repeat 64..89 CDD:275381 8/24 (33%)
leucine-rich repeat 90..114 CDD:275381 8/26 (31%)
leucine-rich repeat 115..145 CDD:275381 9/30 (30%)
leucine-rich repeat 146..170 CDD:275381 9/29 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.