DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and AT3G07550

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_566312.1 Gene:AT3G07550 / 819944 AraportID:AT3G07550 Length:395 Species:Arabidopsis thaliana


Alignment Length:392 Identity:87/392 - (22%)
Similarity:133/392 - (33%) Gaps:106/392 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 DLSQFLADNCVDGEAA-APQICLTDLPFEILLRILSYLDLKSLFRVGHVSRTFYDISRHPLLYA- 367
            |:|:  :||.|:.... .|..||:    .|..|:.|..|..|.....|......:|||..|.:. 
plant     3 DVSE--SDNNVETSIIHLPDDCLS----FIFQRLDSVADHDSFGLTCHRWLNIQNISRRSLQFQC 61

  Fly   368 ------EISLKPYWDVASSELLCTLARRATMLRKLDLSWCGGFGNVSPTEFKKFLTQRGDNLTHL 426
                  ..||.......||..|..|..|...|..|.||.|....:.|...    |...|..|..|
plant    62 SFSVLNPSSLSQTNPDVSSHHLHRLLTRFQWLEHLSLSGCTVLNDSSLDS----LRYPGARLHTL 122

  Fly   427 RLNSCKFLNASCIENVGIVCDNLIELSLRNCATEPPLLNFSCLANLKNLERLDLFQTYFETELLL 491
            .|:.|..::...|..:...|.||..:||..|       |.|.: .|:.|.|..|           
plant   123 YLDCCFGISDDGISTIASFCPNLSVVSLYRC-------NISDI-GLETLARASL----------- 168

  Fly   492 SMLEGNRKLKHLNLAFCGVSVNMDNVAAHLATYNTQLISLDLWKAHFLSSRGLQSLAR-LHQLEE 555
                   .||.:||::|.:                            :|..|:::|:: ..|||.
plant   169 -------SLKCVNLSYCPL----------------------------VSDFGIKALSQACLQLES 198

  Fly   556 LDLGWCMREASLGDGLFQLLSNC---------------PK----------LKKLFLSAVRGTTER 595
            :.:..|.....:|      .|.|               ||          ::.|.:|.|.....:
plant   199 VKISNCKSITGVG------FSGCSPTLGYVDADSCQLEPKGITGIISGGGIEFLNISGVSCYIRK 257

  Fly   596 D-LMHI-AALGKNLEQLDLMGILNITHERVYDILVNCPKLQLLDLSFCDNIMDRDFDLLAEWSRQ 658
            | |:.| :.:...|..|:|.....:..|.:..|...||.||..:|:.|..:....::.:.:|.|.
plant   258 DGLVPIGSGIASKLRILNLRMCRTVGDESIEAIAKGCPLLQEWNLALCHEVKISGWEAVGKWCRN 322

  Fly   659 FK 660
            .|
plant   323 LK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 12/52 (23%)
leucine-rich repeat 393..422 CDD:275381 8/28 (29%)
leucine-rich repeat 423..442 CDD:275381 5/18 (28%)
LRR_RI 437..>641 CDD:238064 46/231 (20%)
leucine-rich repeat 449..474 CDD:275381 7/24 (29%)
leucine-rich repeat 475..499 CDD:275381 3/23 (13%)
leucine-rich repeat 500..527 CDD:275381 5/26 (19%)
leucine-rich repeat 528..552 CDD:275381 3/24 (13%)
AMN1 552..>660 CDD:187754 28/134 (21%)
leucine-rich repeat 553..580 CDD:275381 6/41 (15%)
leucine-rich repeat 581..606 CDD:275381 6/26 (23%)
leucine-rich repeat 607..632 CDD:275381 6/24 (25%)
leucine-rich repeat 633..652 CDD:275381 4/18 (22%)
AT3G07550NP_566312.1 leucine-rich repeat 93..118 CDD:275381 8/28 (29%)
leucine-rich repeat 119..144 CDD:275381 6/24 (25%)
AMN1 142..361 CDD:187754 49/243 (20%)
leucine-rich repeat 145..169 CDD:275381 10/49 (20%)
leucine-rich repeat 170..195 CDD:275381 8/52 (15%)
leucine-rich repeat 196..270 CDD:275381 14/79 (18%)
leucine-rich repeat 271..296 CDD:275381 6/24 (25%)
leucine-rich repeat 297..322 CDD:275381 5/24 (21%)
leucine-rich repeat 323..346 CDD:275381 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.