Sequence 1: | NP_572951.1 | Gene: | Fbxl4 / 32378 | FlyBaseID: | FBgn0030555 | Length: | 669 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001038919.1 | Gene: | amn1 / 751744 | ZFINID: | ZDB-GENE-060825-13 | Length: | 249 | Species: | Danio rerio |
Alignment Length: | 252 | Identity: | 58/252 - (23%) |
---|---|---|---|
Similarity: | 102/252 - (40%) | Gaps: | 49/252 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 416 LTQRGDNLTHLRL--NSCKFLNASCIENVGIVCDNLIE---------LSLRNCATEPPLLNFSCL 469
Fly 470 ANLKNLERLDLFQTYFETELLLSMLEGNRKLKHLNLAFCGVSVNMDNVAAHLATYNTQLISLDLW 534
Fly 535 KAHFLSSRGLQSLAR-LHQLEELDLGWCMREASLGD-GLFQLLSNCPKLKKLFLSAVRGTTERDL 597
Fly 598 MHIA--ALGKNLEQLDLMGILNITHERVYDILVNCPKLQLLDLSFCDNIMDRDFDLL 652 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fbxl4 | NP_572951.1 | F-box-like | 326..372 | CDD:289689 | |
leucine-rich repeat | 393..422 | CDD:275381 | 2/5 (40%) | ||
leucine-rich repeat | 423..442 | CDD:275381 | 3/20 (15%) | ||
LRR_RI | 437..>641 | CDD:238064 | 49/216 (23%) | ||
leucine-rich repeat | 449..474 | CDD:275381 | 7/33 (21%) | ||
leucine-rich repeat | 475..499 | CDD:275381 | 5/23 (22%) | ||
leucine-rich repeat | 500..527 | CDD:275381 | 4/26 (15%) | ||
leucine-rich repeat | 528..552 | CDD:275381 | 8/24 (33%) | ||
AMN1 | 552..>660 | CDD:187754 | 26/104 (25%) | ||
leucine-rich repeat | 553..580 | CDD:275381 | 10/27 (37%) | ||
leucine-rich repeat | 581..606 | CDD:275381 | 4/26 (15%) | ||
leucine-rich repeat | 607..632 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 633..652 | CDD:275381 | 3/18 (17%) | ||
amn1 | NP_001038919.1 | AMN1 | 33..248 | CDD:187754 | 54/234 (23%) |
leucine-rich repeat | 59..72 | CDD:275381 | 4/17 (24%) | ||
leucine-rich repeat | 82..107 | CDD:275381 | 8/41 (20%) | ||
leucine-rich repeat | 108..133 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 134..159 | CDD:275381 | 10/27 (37%) | ||
leucine-rich repeat | 160..186 | CDD:275381 | 4/26 (15%) | ||
leucine-rich repeat | 187..212 | CDD:275381 | 8/24 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |