DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and FBXL17

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_005272105.1 Gene:FBXL17 / 64839 HGNCID:13615 Length:712 Species:Homo sapiens


Alignment Length:441 Identity:86/441 - (19%)
Similarity:151/441 - (34%) Gaps:145/441 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 PPPDAIGSTSGDG----SGGSISHKLRTLKFQPNCGEDGATKLHEFINNDLSQFLADNCVDGEAA 320
            |||   .|.:.:|    :||.......|...       .|.:.||..:.|..:...:.|......
Human   260 PPP---SSPTSEGAPTEAGGDAVRAGGTAPL-------SAQQQHECGDADCRESPENPCDCHREP 314

  Fly   321 APQI-CLTDLPFEILLRILSYLDLKSLFRVGHVSRTFYDISRHPLLYAEISLKPYWDVASSELLC 384
            .|:. .:..||..|||:|.|.|.|.                 ...|.|.:..| ||.        
Human   315 PPETPDINQLPPSILLKIFSNLSLD-----------------ERCLSASLVCK-YWR-------- 353

  Fly   385 TLARRATMLRKLDLSWCGGFGNVSPT-EFKKFLTQRGDNLTHLRLNSCKFL--NASCIENVGIVC 446
            .|.......::||||     .....| |..:.:..|..|:..:.::.|:.:  |..|:  :...|
Human   354 DLCLDFQFWKQLDLS-----SRQQVTDELLEKIASRSQNIIEINISDCRSMSDNGVCV--LAFKC 411

  Fly   447 DNLIELSLRNCATEPPLLNFSCLANLKNLERLDLFQTYFETELLLSMLEGNRKLKHLNLAFCGVS 511
            ..|:..:...|               |.|.         :|.::.                    
Human   412 PGLLRYTAYRC---------------KQLS---------DTSIIA-------------------- 432

  Fly   512 VNMDNVAAHLATYNTQLISLDLWKAHF-----LSSRGLQSL-ARLHQLEELDLGWCMREASLGDG 570
                 ||:|...         |.|.|.     |:..||:.| ::..:|:::..|.|.:.:.  :|
Human   433 -----VASHCPL---------LQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISD--EG 481

  Fly   571 LFQLLSNCPKLKKLFLSAVRGTTER----------DLMHIAALG--------------KNLEQLD 611
            :..:...|.||:::::...:..|::          :|.::..:|              :||..||
Human   482 MIVIAKGCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLRNLSSLD 546

  Fly   612 LMGILNITHERVYDILVNCPKLQLLDLSFCDN--IMDRDFDLLAEWSRQFK 660
            |..|..:.:|.|.:|:..|..|..|:|  |.|  |.||..:::|:..:..|
Human   547 LRHITELDNETVMEIVKRCKNLSSLNL--CLNWIINDRCVEVIAKEGQNLK 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 11/45 (24%)
leucine-rich repeat 393..422 CDD:275381 7/29 (24%)
leucine-rich repeat 423..442 CDD:275381 3/20 (15%)
LRR_RI 437..>641 CDD:238064 40/233 (17%)
leucine-rich repeat 449..474 CDD:275381 2/24 (8%)
leucine-rich repeat 475..499 CDD:275381 2/23 (9%)
leucine-rich repeat 500..527 CDD:275381 3/26 (12%)
leucine-rich repeat 528..552 CDD:275381 7/29 (24%)
AMN1 552..>660 CDD:187754 29/133 (22%)
leucine-rich repeat 553..580 CDD:275381 5/26 (19%)
leucine-rich repeat 581..606 CDD:275381 4/48 (8%)
leucine-rich repeat 607..632 CDD:275381 9/24 (38%)
leucine-rich repeat 633..652 CDD:275381 8/20 (40%)
FBXL17XP_005272105.1 F-box-like 321..368 CDD:289689 17/72 (24%)
leucine-rich repeat 362..387 CDD:275381 7/29 (24%)
leucine-rich repeat 388..413 CDD:275381 4/26 (15%)
AMN1 411..573 CDD:187754 38/221 (17%)
leucine-rich repeat 414..439 CDD:275381 8/73 (11%)
leucine-rich repeat 440..465 CDD:275381 7/24 (29%)
leucine-rich repeat 466..491 CDD:275381 5/26 (19%)
leucine-rich repeat 492..517 CDD:275381 2/24 (8%)
leucine-rich repeat 518..541 CDD:275381 2/22 (9%)
leucine-rich repeat 542..567 CDD:275381 9/24 (38%)
AMN1 547..>652 CDD:187754 16/51 (31%)
leucine-rich repeat 568..593 CDD:275381 9/26 (35%)
leucine-rich repeat 594..615 CDD:275381 1/2 (50%)
leucine-rich repeat 619..641 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.