DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and fbxl3l

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_693270.2 Gene:fbxl3l / 564855 ZFINID:ZDB-GENE-130530-598 Length:448 Species:Danio rerio


Alignment Length:399 Identity:83/399 - (20%)
Similarity:120/399 - (30%) Gaps:150/399 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 DLPFEILLRILSYLDLKSLFRVGHVSR-----------------------TFYDISRHPLLYAEI 369
            :||..::|.|..||.|....|...|.|                       |.|..|.||.|..:|
Zfish    58 NLPHHVVLHIFQYLSLVDRARASSVCRRWNEVFHIPDLWRRFEFELNQPATSYLRSTHPDLIQQI 122

  Fly   370 -----------SLKPYWDVASSELLCTLARRAT--MLRKLDLSWCG--GFGNVSPTEFKKFLT-- 417
                       |.|......|:|..|.:..:..  .::.|.|....  .|.:||.:.|...||  
Zfish   123 IKRHAQHLQYVSFKVDSCTESAEAACNILSQLVNCTIKTLGLISTARPSFMDVSQSHFVSALTVV 187

  Fly   418 ---------------------------QRGDNLTHLRLNSCKFLNASCIENVGIVCDNLIELSLR 455
                                       ...|.|..|:::||..::.:.|..|...|..|.||:  
Zfish   188 FVNSKSLSSIKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELA-- 250

  Fly   456 NCATEPPLLNFSCLANLKNLERLDLFQTYFETELLLSMLEGNRKLKHLNLAFCGVSVNMDNVAAH 520
                    ||:..|::                ||||::    ...||::|....:.|..:|..  
Zfish   251 --------LNYHLLSD----------------ELLLAL----SSEKHVHLEHLRIDVVSENPG-- 285

  Fly   521 LATYNTQL--ISLDLWKAHFLSSRGLQSLARLHQLEE--------------LDLGWCMREASLGD 569
                .||.  |....|.|....|..:..:......||              |..|..:.:..||.
Zfish   286 ----QTQFHTIKKSSWDALIRHSPQVNIVMYFFLYEEEFEPFFREETPVTHLYFGRAVSKDMLGR 346

  Fly   570 -GLFQLLSNCPKLKKLFLSAVRGTTERDLMHIAALGKNLEQLDLMGILNITHERVYDILVNCPKL 633
             ||     |||:|.:|.:.|                ..||.||         |.:..|...|..|
Zfish   347 IGL-----NCPRLVELVVCA----------------NGLEPLD---------EELIRIADRCKSL 381

  Fly   634 QLLDLSFCD 642
            ..:.|..|:
Zfish   382 TAIGLGECE 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 18/77 (23%)
leucine-rich repeat 393..422 CDD:275381 8/59 (14%)
leucine-rich repeat 423..442 CDD:275381 5/18 (28%)
LRR_RI 437..>641 CDD:238064 47/220 (21%)
leucine-rich repeat 449..474 CDD:275381 6/24 (25%)
leucine-rich repeat 475..499 CDD:275381 4/23 (17%)
leucine-rich repeat 500..527 CDD:275381 5/26 (19%)
leucine-rich repeat 528..552 CDD:275381 4/25 (16%)
AMN1 552..>660 CDD:187754 24/106 (23%)
leucine-rich repeat 553..580 CDD:275381 10/41 (24%)
leucine-rich repeat 581..606 CDD:275381 3/24 (13%)
leucine-rich repeat 607..632 CDD:275381 7/24 (29%)
leucine-rich repeat 633..652 CDD:275381 3/10 (30%)
fbxl3lXP_693270.2 F-box-like 56..99 CDD:289689 10/40 (25%)
leucine-rich repeat 194..218 CDD:275381 0/23 (0%)
leucine-rich repeat 220..245 CDD:275381 7/24 (29%)
leucine-rich repeat 246..271 CDD:275381 12/54 (22%)
leucine-rich repeat 272..306 CDD:275381 9/39 (23%)
leucine-rich repeat 307..353 CDD:275381 10/50 (20%)
AMN1 <347..>412 CDD:187754 18/74 (24%)
leucine-rich repeat 354..380 CDD:275381 10/50 (20%)
leucine-rich repeat 381..403 CDD:275381 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.