DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and FBXL12

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_016882401.1 Gene:FBXL12 / 54850 HGNCID:13611 Length:343 Species:Homo sapiens


Alignment Length:270 Identity:66/270 - (24%)
Similarity:101/270 - (37%) Gaps:80/270 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 SSELLCTLARRATMLRKL-----DLSWCGGFGNVSPTEFKKFLTQRGDNLTHLRLNSCKFLNASC 438
            |..||..|.::...|::|     |||       :.|      :|.....|..|.|:||:.     
Human   107 SPALLRALGQKCPNLKRLCLHVADLS-------MVP------ITSLPSTLRTLELHSCEI----- 153

  Fly   439 IENVGIVCDNLIELSLRNCATEPPLLNFSCLANLKNLERLDLFQTYFETELLLSMLEGNRKLKHL 503
                     ::..|..:...|..|||  .|:.    |:|:..|:.        ..|:|..:.:.|
Human   154 ---------SMAWLHKQQDPTVLPLL--ECIV----LDRVPAFRD--------EHLQGLTRFRAL 195

  Fly   504 NLAFCGVSVNMDNVAAHLATYNTQLISLDLWKAHFLSSRGLQSLARLHQLEELDLGWCMREASLG 568
            .....|            .||......||         .|||.|:.|.:||.|.   |...|.  
Human   196 RSLVLG------------GTYRVTETGLD---------AGLQELSYLQRLEVLG---CTLSAD-- 234

  Fly   569 DGLFQLLSNCPKLKKLFLSAVRGTTERDLMHIAALGKNLEQLDLMGILNITHE--RVYDILVNC- 630
            ..|..:..:...::|:.|: |||.:...|..:..: ..||.|.|.|.| :|.|  ...:||.:| 
Human   235 STLLAISRHLRDVRKIRLT-VRGLSAPGLAVLEGM-PALESLCLQGPL-VTPEMPSPTEILSSCL 296

  Fly   631 --PKLQLLDL 638
              |||::|:|
Human   297 TMPKLRVLEL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689
leucine-rich repeat 393..422 CDD:275381 7/33 (21%)
leucine-rich repeat 423..442 CDD:275381 5/18 (28%)
LRR_RI 437..>641 CDD:238064 50/207 (24%)
leucine-rich repeat 449..474 CDD:275381 6/24 (25%)
leucine-rich repeat 475..499 CDD:275381 5/23 (22%)
leucine-rich repeat 500..527 CDD:275381 4/26 (15%)
leucine-rich repeat 528..552 CDD:275381 7/23 (30%)
AMN1 552..>660 CDD:187754 28/92 (30%)
leucine-rich repeat 553..580 CDD:275381 6/26 (23%)
leucine-rich repeat 581..606 CDD:275381 6/24 (25%)
leucine-rich repeat 607..632 CDD:275381 11/29 (38%)
leucine-rich repeat 633..652 CDD:275381 3/6 (50%)
FBXL12XP_016882401.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.