DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and FBXL19

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001093254.2 Gene:FBXL19 / 54620 HGNCID:25300 Length:694 Species:Homo sapiens


Alignment Length:300 Identity:71/300 - (23%)
Similarity:106/300 - (35%) Gaps:70/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 LPFEILLRILSYLDLKSLFRVGHVSRTF------------YDISRHPLLYAEISLKPYWDVASSE 381
            ||....||:..:|..:.|.....|.||:            .|:||..      ||.|       .
Human   424 LPRAAWLRVFQHLGPRELCICMRVCRTWSRWCYDKRLWPRMDLSRRK------SLTP-------P 475

  Fly   382 LLCTLARRATMLRKLDLSWCGGFGNVSPTEFKKFLTQRGDNLTHLRLNSCKFLNASCIENVGIVC 446
            :|..:.||..  |.|||||.|    ||..:. .:|..|...|..|.|:.|.:|:.|.:.:..:..
Human   476 MLSGVVRRQP--RALDLSWTG----VSKKQL-MWLLNRLQGLQELVLSGCSWLSVSALGSAPLPA 533

  Fly   447 DNLIEL---------SLRNCATEPPLL---NFSCLANLKNLERLDLFQTYFETELLLSMLEGNRK 499
            ..|::|         .||.....||..   .......|:.:..|.|.........|..:|....:
Human   534 LRLLDLRWIEDVKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQ 598

  Fly   500 LKHLNLAFCGVSVNMDNVAAHLATYNTQLISLDLWKAHFLSSRGLQSLARLHQLEELDLGWCMRE 564
            |..|:|:.|   .::.:.:.||.|..|..:.                    ..|..|:|..|.| 
Human   599 LSALDLSHC---AHVGDPSVHLLTAPTSPLR--------------------ETLVHLNLAGCHR- 639

  Fly   565 ASLGDGLFQLLSNCPKLKKLFLSAVRGTTERDLMHIAALG 604
              |.|....|...||:|::|.|.:.|..:......:||.|
Human   640 --LTDHCLPLFRRCPRLRRLDLRSCRQLSPEACARLAAAG 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 13/54 (24%)
leucine-rich repeat 393..422 CDD:275381 11/28 (39%)
leucine-rich repeat 423..442 CDD:275381 6/18 (33%)
LRR_RI 437..>641 CDD:238064 36/179 (20%)
leucine-rich repeat 449..474 CDD:275381 7/36 (19%)
leucine-rich repeat 475..499 CDD:275381 4/23 (17%)
leucine-rich repeat 500..527 CDD:275381 7/26 (27%)
leucine-rich repeat 528..552 CDD:275381 0/23 (0%)
AMN1 552..>660 CDD:187754 16/52 (31%)
leucine-rich repeat 553..580 CDD:275381 9/26 (35%)
leucine-rich repeat 581..606 CDD:275381 6/23 (26%)
leucine-rich repeat 607..632 CDD:275381
leucine-rich repeat 633..652 CDD:275381
FBXL19NP_001093254.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
zf-CXXC <50..77 CDD:251032
PHD_FXL19 87..148 CDD:277115
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..420
F-box-like 424..465 CDD:315592 9/40 (23%)
leucine-rich repeat 461..485 CDD:275381 9/36 (25%)
AMN1 466..665 CDD:332986 58/244 (24%)
leucine-rich repeat 486..508 CDD:275381 11/26 (42%)
LRR 1 492..517 9/29 (31%)
leucine-rich repeat 510..533 CDD:275381 6/22 (27%)
LRR 2 518..541 5/22 (23%)
leucine-rich repeat 534..573 CDD:275381 7/38 (18%)
leucine-rich repeat 574..598 CDD:275381 4/23 (17%)
LRR 3 581..606 5/24 (21%)
leucine-rich repeat 599..623 CDD:275381 7/26 (27%)
LRR 4 607..636 8/51 (16%)
leucine-rich repeat 629..653 CDD:275381 9/26 (35%)
LRR 5 637..661 10/26 (38%)
leucine-rich repeat 654..686 CDD:275381 6/23 (26%)
LRR 6 662..694 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.