DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and FipoQ

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster


Alignment Length:471 Identity:108/471 - (22%)
Similarity:157/471 - (33%) Gaps:168/471 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 DGEAAAP--QICLTDLPFEILLRILSYLDLKSLFRVGHVSRTFYDISRHPLLYAEISLKPY---W 375
            ||...:|  ...:..||.::||.|.|||..:.:.|:..:.|.:..|:....|:..:||:|.   .
  Fly    22 DGTVRSPFADTTIEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNVSLRPEVSGL 86

  Fly   376 DVASSELLCTL--ARRATMLRKLDLSWCGGFGNVSPTEFKKF-----LTQRGDNLTHLRLN---- 429
            .|.|.|:|..|  .|....||.::|          |.|....     |:.:..||||:.|:    
  Fly    87 HVGSLEMLLQLISVRFGPTLRYIEL----------PIELITHTVLHELSAKCPNLTHMLLDFSTA 141

  Fly   430 ------------------SC-----------------KFLNA-----------SCIE-------- 440
                              .|                 .|:|.           .|.|        
  Fly   142 MQLHDFSEMQAFPTKLRYMCVCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEV 206

  Fly   441 -------------------NVGIVCDNLIELSLRNC-ATEPPLLNF------------------- 466
                               .:..:.|:.|:....|| ..|...:||                   
  Fly   207 INVHKLKSATPNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRL 271

  Fly   467 SCL----ANLKN------------LERLDLFQTYFETELLLSMLEGNRKLKHLNLAFCGVSVN-- 513
            :||    .:||:            |:.||:..|...||.|:.||.....||.|:..    .:|  
  Fly   272 TCLLMNGTSLKSEFVMQAEWDKCALQELDITATDLSTECLVDMLSRIPSLKFLSAG----QINGF 332

  Fly   514 MDNVAAHLATYNT--QLISLDLWKAHFLSSRGLQSLARL--HQLEELDL-GWCMREASLGDGLFQ 573
            .|:|........|  .||||||..:..:|..||....:.  |||....| |.......|...:..
  Fly   333 NDSVLKQWMESGTTRSLISLDLDSSDNISDEGLLKFIQRQGHQLSACCLSGMPHITDQLWMSILP 397

  Fly   574 LLSNCPKLKKLFLSAVRGTTER--------DLMH-IAALGKNLEQLDLMG-----ILNITHERVY 624
            ||.||..:       |.||.|:        .||. ||:...|||:|:|..     ..:...::..
  Fly   398 LLGNCKII-------VMGTAEKLGVNIHVDQLMDTIASNCGNLERLELRWDPDNLRFSDKSQKAI 455

  Fly   625 DIL-VNCPKLQLLDLS 639
            ||| |.|.||:.:.||
  Fly   456 DILRVKCLKLRCMVLS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 13/45 (29%)
leucine-rich repeat 393..422 CDD:275381 6/33 (18%)
leucine-rich repeat 423..442 CDD:275381 9/95 (9%)
LRR_RI 437..>641 CDD:238064 70/288 (24%)
leucine-rich repeat 449..474 CDD:275381 9/48 (19%)
leucine-rich repeat 475..499 CDD:275381 9/23 (39%)
leucine-rich repeat 500..527 CDD:275381 7/30 (23%)
leucine-rich repeat 528..552 CDD:275381 9/25 (36%)
AMN1 552..>660 CDD:187754 31/104 (30%)
leucine-rich repeat 553..580 CDD:275381 8/27 (30%)
leucine-rich repeat 581..606 CDD:275381 8/33 (24%)
leucine-rich repeat 607..632 CDD:275381 9/30 (30%)
leucine-rich repeat 633..652 CDD:275381 3/7 (43%)
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 13/45 (29%)
leucine-rich repeat 131..156 CDD:275381 4/24 (17%)
leucine-rich repeat 157..175 CDD:275381 1/17 (6%)
leucine-rich repeat 219..244 CDD:275381 4/24 (17%)
leucine-rich repeat 245..270 CDD:275381 3/24 (13%)
leucine-rich repeat 271..295 CDD:275381 4/23 (17%)
leucine-rich repeat 296..320 CDD:275381 9/23 (39%)
leucine-rich repeat 321..348 CDD:275381 7/30 (23%)
leucine-rich repeat 349..375 CDD:275381 9/25 (36%)
leucine-rich repeat 376..403 CDD:275381 7/26 (27%)
leucine-rich repeat 405..432 CDD:275381 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457990
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.