DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and CG14891

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster


Alignment Length:546 Identity:115/546 - (21%)
Similarity:186/546 - (34%) Gaps:167/546 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 NYYTEIDAIMLCGRTVTKTQNLLAKQQITQHSRTLVSPPPDAIGSTSGDGSGGSISHKLRTLKFQ 287
            |:|.|        |.|..|::....:|:|                         ||...|.||:|
  Fly    10 NFYIE--------RGVAYTEDREVVRQLT-------------------------ISGSRRFLKYQ 41

  Fly   288 ----------------PNCGEDGATKLHEFINNDLSQFLADNCVDGEAAAPQ------------- 323
                            ......|:...:|..:...:.:...:.:||.....|             
  Fly    42 LLKYFSIFGKVEKLHWKKKKRSGSVLFYEATHAAKALYCTKHTIDGHDLYLQASTSWHPTPVEES 106

  Fly   324 --ICLTDLPF--EILLRILSYLDLKSLFRVGHVSRTF---YDISRHPLLYAEISLKPYWDVASSE 381
              :...|||.  :|..::|.||.|............|   |::..|.:.:          |.:.:
  Fly   107 GTLSAYDLPITDDIWWKVLDYLSLNERLNFAASCERFQAIYELDSHRINH----------VLNMK 161

  Fly   382 LLCTLARRATMLRKLDL-----SWCGGFGNVSP-----TEFKKFLTQRGDNLTHLRLNSCKFLNA 436
            .:|||..|  ::::|.|     ..|...|.:.|     |||.:.|.....|||.|..    |..:
  Fly   162 DVCTLTHR--VIKRLMLLSGKHIHCVTGGPLHPNWPYLTEFVQLLGVSCPNLTELSF----FKIS 220

  Fly   437 SCIENVGIVCD------NLIELSLRNCATEPPLLNFSCLANLKNLERLDLFQTY----------- 484
            ..:.::..:.|      |:..:|||.|..:.  .:..||..|..|:.||:.:.:           
  Fly   221 VSLAHMTHLFDGANGLINITNISLRRCNLKD--AHIYCLQMLSKLKSLDIRENFSIKGDSLKSLP 283

  Fly   485 FETELL------------LSMLEGNRKLKHLNLAFCG--VSVNMDN-VAAHLATYNTQLISLDLW 534
            ...|:|            |..|..   |.||....|.  |....|| :...||.|...|..|:| 
  Fly   284 ISLEILNVSGCVDLSPKCLIQLAA---LSHLRELRCPGIVKFAKDNELYGRLAHYCPMLEVLEL- 344

  Fly   535 KAHFLSSRGLQSLARLHQL-----EELDL------------GWCMREASLGDGL---------FQ 573
             ..|::...|..|:|||.|     .:||.            .:.:|...:.|..         ..
  Fly   345 -TDFMNVIQLGGLSRLHTLVIHSSAQLDYHVNNVLLTSIAESYSLRHLEILDSFGPMSDTSFDLS 408

  Fly   574 LLSNCPKLKKLFLSAVRGTTERDLMHIAALGK--NLEQLDLMGILNITHERVYDILVNCPKLQLL 636
            :.|...:|:.|.|.....||    :|:..|.|  .||.|||.|..|:::|.|..:..:...|:.|
  Fly   409 IFSQLKELRTLILHNQNFTT----LHLMGLQKLSTLEFLDLSGSPNLSNEVVAKLTKSLSGLRRL 469

  Fly   637 DLSFCDNIMDRDFDLLAEWSRQFKVD 662
            .:.||. ::.|....:.|.:.:.:||
  Fly   470 KVDFCP-LITRQLTKILEGNPKLQVD 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 11/50 (22%)
leucine-rich repeat 393..422 CDD:275381 9/38 (24%)
leucine-rich repeat 423..442 CDD:275381 4/18 (22%)
LRR_RI 437..>641 CDD:238064 60/263 (23%)
leucine-rich repeat 449..474 CDD:275381 7/24 (29%)
leucine-rich repeat 475..499 CDD:275381 7/46 (15%)
leucine-rich repeat 500..527 CDD:275381 10/29 (34%)
leucine-rich repeat 528..552 CDD:275381 8/23 (35%)
AMN1 552..>660 CDD:187754 29/135 (21%)
leucine-rich repeat 553..580 CDD:275381 6/52 (12%)
leucine-rich repeat 581..606 CDD:275381 8/26 (31%)
leucine-rich repeat 607..632 CDD:275381 9/24 (38%)
leucine-rich repeat 633..652 CDD:275381 5/18 (28%)
CG14891NP_650560.1 RRM_6 25..91 CDD:290958 12/90 (13%)
AMN1 <199..352 CDD:187754 38/163 (23%)
leucine-rich repeat 211..237 CDD:275381 5/29 (17%)
leucine-rich repeat 239..262 CDD:275381 7/24 (29%)
leucine-rich repeat 263..285 CDD:275381 3/21 (14%)
leucine-rich repeat 286..338 CDD:275381 14/54 (26%)
leucine-rich repeat 339..387 CDD:275381 12/49 (24%)
leucine-rich repeat 388..415 CDD:275381 3/26 (12%)
leucine-rich repeat 416..439 CDD:275381 8/26 (31%)
leucine-rich repeat 440..465 CDD:275381 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458001
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.