DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and Fbxl7

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster


Alignment Length:480 Identity:115/480 - (23%)
Similarity:175/480 - (36%) Gaps:138/480 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 ITQHSRTLVSPPPDAIGSTSGDG--------SGGSISHKLRTLKFQPNCGEDGATKLHEFINNDL 306
            :.|...|||||.|....|:.|.|        ||..|... .|....|..|               
  Fly   322 LDQGYATLVSPSPTGHHSSGGAGNVTNSTTASGAGIMAS-STPTTTPRRG--------------- 370

  Fly   307 SQFLADNCVDGEAAA-----------PQIC--LTD-LPFEILLRILSYLDLKSLFRVGHVSRTFY 357
               .:.|.:.|.||:           |..|  |.| ||.|.::||.|:||...|..|..|.|.|.
  Fly   371 ---ASSNGLGGGAASAIGPPPWNRKGPFRCGPLFDRLPDEAVVRIFSWLDSCELCNVARVCRRFE 432

  Fly   358 DISRHPLLYAEISLKPYWDVASSELLCTLARRATMLRKLDLSWCGGFGNVSPTEFKK-------- 414
            .::..|:|:..|||:       .|.|........:.|:|    ||...|.:..|.::        
  Fly   433 HLAWRPILWKVISLR-------GEHLNGDKTLKMIFRQL----CGQSCNGACPEVERVMLADGCR 486

  Fly   415 -------FLTQRGDNLTHLRLNSCKFLNASCIENVGIVCDNLIELSLRNCA----------TEPP 462
                   .||:|...||||:|.:|..:....:......|.||..|.:..|:          .|||
  Fly   487 ISDKGLQLLTRRCPELTHLQLQTCVDITNQALVEALTKCSNLQHLDVTGCSQVSSISPNPHMEPP 551

  Fly   463 ---LLNF----SCLA--------NLKNLERLDLFQTYFETELLLSMLEGNRK--------LKHLN 504
               ||.:    .|:|        .:||..:|    .|......:.:.:...|        ||.|:
  Fly   552 RRLLLQYLDLTDCMAIDDMGLKIVVKNCPQL----VYLYLRRCIQVTDAGLKFVPSFCVSLKELS 612

  Fly   505 LAFCGVSVNMDNVAAH-LATYNTQLISLDLWKAHFLSSRGLQSLA-RLHQLEELDLGWCMREASL 567
            ::.|   :|:.:...: ||.....|..|.:.|...:|..||:.:| |.::|..|:...|  ||..
  Fly   613 VSDC---LNITDFGLYELAKLGAALRYLSVAKCERVSDAGLKVIARRCYKLRYLNARGC--EAVS 672

  Fly   568 GDGLFQLLSNCPKLKKLFLSAVRGTTERDLMHIAALGKNLEQLDLMGILNITHERVYDILVNCPK 632
            .|.:..|..:||:|:.|.:                           |..:::...:..:..:||.
  Fly   673 DDSITVLARSCPRLRALDI---------------------------GKCDVSDAGLRALAESCPN 710

  Fly   633 LQLLDLSFCDNIMDRDFDLLAEWSR 657
            |:.|.|..||.|.||....:|.:.|
  Fly   711 LKKLSLRSCDMITDRGVQCIAYYCR 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 19/46 (41%)
leucine-rich repeat 393..422 CDD:275381 9/43 (21%)
leucine-rich repeat 423..442 CDD:275381 6/18 (33%)
LRR_RI 437..>641 CDD:238064 49/238 (21%)
leucine-rich repeat 449..474 CDD:275381 10/49 (20%)
leucine-rich repeat 475..499 CDD:275381 2/23 (9%)
leucine-rich repeat 500..527 CDD:275381 7/27 (26%)
leucine-rich repeat 528..552 CDD:275381 8/24 (33%)
AMN1 552..>660 CDD:187754 24/106 (23%)
leucine-rich repeat 553..580 CDD:275381 8/26 (31%)
leucine-rich repeat 581..606 CDD:275381 2/24 (8%)
leucine-rich repeat 607..632 CDD:275381 2/24 (8%)
leucine-rich repeat 633..652 CDD:275381 8/18 (44%)
Fbxl7NP_650512.1 F-box-like 401..447 CDD:289689 18/45 (40%)
leucine-rich repeat 441..460 CDD:275381 5/25 (20%)
AMN1 <451..595 CDD:187754 32/151 (21%)
leucine-rich repeat 476..501 CDD:275381 3/24 (13%)
leucine-rich repeat 502..521 CDD:275381 6/18 (33%)
leucine-rich repeat 528..555 CDD:275381 6/26 (23%)
leucine-rich repeat 556..581 CDD:275381 5/24 (21%)
AMN1 577..746 CDD:187754 44/195 (23%)
leucine-rich repeat 582..607 CDD:275381 3/28 (11%)
leucine-rich repeat 608..633 CDD:275381 7/27 (26%)
leucine-rich repeat 634..659 CDD:275381 8/24 (33%)
leucine-rich repeat 660..685 CDD:275381 8/26 (31%)
leucine-rich repeat 686..710 CDD:275381 4/50 (8%)
leucine-rich repeat 711..735 CDD:275381 9/23 (39%)
leucine-rich repeat 737..761 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457929
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.