DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and fbxl15

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_998107.1 Gene:fbxl15 / 405878 ZFINID:ZDB-GENE-040426-2440 Length:296 Species:Danio rerio


Alignment Length:349 Identity:73/349 - (20%)
Similarity:131/349 - (37%) Gaps:102/349 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 LTDLPFEILL--RILSYLDLKSLFRVGHVSRTFYDISRHPLLYAEISLKPYWDVASS------EL 382
            |.|||:|.:|  .:..:|.|:.|..:..||::|     ..|:...:.....:|.|.:      |.
Zfish    16 LLDLPWEDVLVSHVFCHLPLRLLVSLQRVSKSF-----RSLIQVYLDNCRTFDPAQTGPHIPREA 75

  Fly   383 LCTLARRATMLRKLDLSWCGGFGNVSPTEFKKFLTQRGDNLTHLRLNSCKFLNASCIENVGIVCD 447
            .|::.|...:|:.|.::.|..:  ::.|:....:.| ...|.|:.|..|..|:...:..|.:.|.
Zfish    76 FCSILRHNQVLQHLSVTNCSDW--ITDTDLLPVIGQ-NQQLQHVDLRGCAQLSRRALVAVSLSCP 137

  Fly   448 NLIELSLRNCATEPPLLNFSCLANLKNLERLDLFQTYFETELLLSMLEGNRKLKHLNLAFCGVSV 512
                                                               :|:||:||.|    
Zfish   138 ---------------------------------------------------RLQHLSLAHC---- 147

  Fly   513 NMDNVAAHLATYNTQLISLDLWKAHFLSSRGLQSLA-RLHQLEELDLGWCMREASLGD-GLFQLL 575
                                    .::.|..|:||| ....|..|||..|.:   |.| .:..|.
Zfish   148 ------------------------EWVDSLALRSLADHCPMLRSLDLTACRQ---LKDPAVCYLA 185

  Fly   576 SNCPKLKKLFLSAVRGTTERDLMHIAALGKNLEQLDLMGILNITHERVYDILVNCPKLQLLDLSF 640
            ..||:|:.|.::.....|:..:..:|...:.:|:|||.|.|.:.:|.:..:...|||||.|.::.
Zfish   186 GKCPELRALSVAVNANITDTAVEEVAKKCREMERLDLTGCLRVRNEAIRTLAEYCPKLQSLKVNH 250

  Fly   641 CDNIMDRDFDLLAEWSRQFKVDIK 664
            |.|:.:....:|..  |..::|::
Zfish   251 CHNVTESSLGVLRR--RNVEIDVE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 13/47 (28%)
leucine-rich repeat 393..422 CDD:275381 5/28 (18%)
leucine-rich repeat 423..442 CDD:275381 5/18 (28%)
LRR_RI 437..>641 CDD:238064 40/205 (20%)
leucine-rich repeat 449..474 CDD:275381 0/24 (0%)
leucine-rich repeat 475..499 CDD:275381 0/23 (0%)
leucine-rich repeat 500..527 CDD:275381 6/26 (23%)
leucine-rich repeat 528..552 CDD:275381 5/24 (21%)
AMN1 552..>660 CDD:187754 31/108 (29%)
leucine-rich repeat 553..580 CDD:275381 9/27 (33%)
leucine-rich repeat 581..606 CDD:275381 4/24 (17%)
leucine-rich repeat 607..632 CDD:275381 8/24 (33%)
leucine-rich repeat 633..652 CDD:275381 5/18 (28%)
fbxl15NP_998107.1 F-box 16..>52 CDD:279040 12/40 (30%)
leucine-rich repeat 51..85 CDD:275381 6/33 (18%)
leucine-rich repeat 86..112 CDD:275381 5/28 (18%)
AMN1 <111..272 CDD:187754 50/244 (20%)
leucine-rich repeat 113..138 CDD:275381 7/75 (9%)
LRR 1 138..159 9/48 (19%)
leucine-rich repeat 139..164 CDD:275381 11/52 (21%)
LRR 2 164..185 7/23 (30%)
leucine-rich repeat 165..190 CDD:275381 9/27 (33%)
LRR 3 190..211 3/20 (15%)
leucine-rich repeat 191..216 CDD:275381 4/24 (17%)
LRR 4 216..237 7/20 (35%)
leucine-rich repeat 217..242 CDD:275381 8/24 (33%)
LRR 5 242..263 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.