Sequence 1: | NP_572951.1 | Gene: | Fbxl4 / 32378 | FlyBaseID: | FBgn0030555 | Length: | 669 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001031579.1 | Gene: | AT4G02733 / 3770467 | AraportID: | AT4G02733 | Length: | 301 | Species: | Arabidopsis thaliana |
Alignment Length: | 258 | Identity: | 59/258 - (22%) |
---|---|---|---|
Similarity: | 91/258 - (35%) | Gaps: | 84/258 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 268 TSGDGSGGSISHKL--RTL-KFQ------PNCGEDGATKLHEFINNDLSQFLADNCVDGEAAAPQ 323
Fly 324 ICLTDLPFEILLRILSYLDLKSLFRVGHVSRTFYDISRHPLLYAEISLKPYWDVASSELLCTLAR 388
Fly 389 RA-TMLRKLDL-----------SWC---------------------GGFGNVSPTEFKKFLTQRG 420
Fly 421 DNLTHLRLNSCKFLN--------ASC-------IENVGIVCDNLIELSLRNCATEPPLLNFSC 468 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fbxl4 | NP_572951.1 | F-box-like | 326..372 | CDD:289689 | 13/45 (29%) |
leucine-rich repeat | 393..422 | CDD:275381 | 10/60 (17%) | ||
leucine-rich repeat | 423..442 | CDD:275381 | 8/33 (24%) | ||
LRR_RI | 437..>641 | CDD:238064 | 10/39 (26%) | ||
leucine-rich repeat | 449..474 | CDD:275381 | 7/20 (35%) | ||
leucine-rich repeat | 475..499 | CDD:275381 | |||
leucine-rich repeat | 500..527 | CDD:275381 | |||
leucine-rich repeat | 528..552 | CDD:275381 | |||
AMN1 | 552..>660 | CDD:187754 | |||
leucine-rich repeat | 553..580 | CDD:275381 | |||
leucine-rich repeat | 581..606 | CDD:275381 | |||
leucine-rich repeat | 607..632 | CDD:275381 | |||
leucine-rich repeat | 633..652 | CDD:275381 | |||
AT4G02733 | NP_001031579.1 | F-box-like | 97..140 | CDD:289689 | 13/42 (31%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D672780at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |