DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and AT4G02733

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001031579.1 Gene:AT4G02733 / 3770467 AraportID:AT4G02733 Length:301 Species:Arabidopsis thaliana


Alignment Length:258 Identity:59/258 - (22%)
Similarity:91/258 - (35%) Gaps:84/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 TSGDGSGGSISHKL--RTL-KFQ------PNCGEDGATKLHEFINNDLSQFLADNCVDGEAAAPQ 323
            :|||   .|:..:|  ||| :|.      ..|.:..||     ::|.:|.|              
plant    54 SSGD---VSVQDQLVDRTLERFSLLLQSTKRCSQKRAT-----LHNSISWF-------------- 96

  Fly   324 ICLTDLPFEILLRILSYLDLKSLFRVGHVSRTFYDISRHPLLYAEISLKPYWDVASSELLCTLAR 388
                 ||.|:.:::.|.:|.|||.:.......|.:.:..||.|..|.|...:......:|.||..
plant    97 -----LPSELTVKVFSMVDTKSLMQASACCTMFNNCAMDPLCYFHIDLTKAFKHVDDRVLRTLLN 156

  Fly   389 RA-TMLRKLDL-----------SWC---------------------GGFGNVSPTEFKKFLTQRG 420
            |: ..||.|.|           |.|                     .|.|::........|...|
plant   157 RSGKQLRSLKLGRVDAPGCLFRSSCLPPLILYGNNARRALKLGRDPPGLGSLFTRSCFDPLKLTG 221

  Fly   421 DNLTHLRLNSCKFLN--------ASC-------IENVGIVCDNLIELSLRNCATEPPLLNFSC 468
            :.||.|.:.|..|:|        ::|       |..|.::.:.::||..|||.....|...:|
plant   222 NLLTSLHIYSLGFMNMNSFLDPLSACSNLTDLKIVGVNVLLEPILELLARNCCLIEHLFLDNC 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 13/45 (29%)
leucine-rich repeat 393..422 CDD:275381 10/60 (17%)
leucine-rich repeat 423..442 CDD:275381 8/33 (24%)
LRR_RI 437..>641 CDD:238064 10/39 (26%)
leucine-rich repeat 449..474 CDD:275381 7/20 (35%)
leucine-rich repeat 475..499 CDD:275381
leucine-rich repeat 500..527 CDD:275381
leucine-rich repeat 528..552 CDD:275381
AMN1 552..>660 CDD:187754
leucine-rich repeat 553..580 CDD:275381
leucine-rich repeat 581..606 CDD:275381
leucine-rich repeat 607..632 CDD:275381
leucine-rich repeat 633..652 CDD:275381
AT4G02733NP_001031579.1 F-box-like 97..140 CDD:289689 13/42 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D672780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.