Sequence 1: | NP_572951.1 | Gene: | Fbxl4 / 32378 | FlyBaseID: | FBgn0030555 | Length: | 669 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102239.1 | Gene: | Fbxl22 / 363083 | RGDID: | 1311830 | Length: | 236 | Species: | Rattus norvegicus |
Alignment Length: | 271 | Identity: | 63/271 - (23%) |
---|---|---|---|
Similarity: | 92/271 - (33%) | Gaps: | 83/271 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 326 LTDLPFEILLRILSYLDLKSLFRVGHVSRTFYDISRHPLLYAEISLKPYWDVASSELLCTLARRA 390
Fly 391 TMLRKLDLSWCGGFGNVSPTE------FKKFLTQRGDNLTHLRLNSCKFLNASCIENVGIVCDNL 449
Fly 450 IELSLRNCATEPPLLNFSCLANLKNLERLDLFQTYFETELLLSMLEGNRKLKHLNLAFCGVSVN- 513
Fly 514 -MDNVAAHLATYNTQLISLDLWKAHFLSSRGLQSLARLHQLEELDLGWCMREASLGDGLFQLLSN 577
Fly 578 CPKLKKLFLSA 588 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fbxl4 | NP_572951.1 | F-box-like | 326..372 | CDD:289689 | 13/45 (29%) |
leucine-rich repeat | 393..422 | CDD:275381 | 7/34 (21%) | ||
leucine-rich repeat | 423..442 | CDD:275381 | 4/18 (22%) | ||
LRR_RI | 437..>641 | CDD:238064 | 36/154 (23%) | ||
leucine-rich repeat | 449..474 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 475..499 | CDD:275381 | 2/23 (9%) | ||
leucine-rich repeat | 500..527 | CDD:275381 | 9/28 (32%) | ||
leucine-rich repeat | 528..552 | CDD:275381 | 3/23 (13%) | ||
AMN1 | 552..>660 | CDD:187754 | 12/37 (32%) | ||
leucine-rich repeat | 553..580 | CDD:275381 | 7/26 (27%) | ||
leucine-rich repeat | 581..606 | CDD:275381 | 4/8 (50%) | ||
leucine-rich repeat | 607..632 | CDD:275381 | |||
leucine-rich repeat | 633..652 | CDD:275381 | |||
Fbxl22 | NP_001102239.1 | F-box-like | 3..43 | CDD:403981 | 12/39 (31%) |
AMN1 | 44..>191 | CDD:187754 | 44/218 (20%) | ||
leucine-rich repeat | 116..141 | CDD:275381 | 9/49 (18%) | ||
leucine-rich repeat | 142..167 | CDD:275381 | 9/44 (20%) | ||
leucine-rich repeat | 168..193 | CDD:275381 | 10/38 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |