DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and CG9003

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster


Alignment Length:506 Identity:117/506 - (23%)
Similarity:205/506 - (40%) Gaps:92/506 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 TTMLTKTLRIDFNHSRLNYYTEIDAIMLCGRTVTKTQNLLAKQQITQHSRTL-------VSPPPD 263
            |.:.:.|.|.:.|.:..|     .::.|.|...:.|:...:.....|||.:.       :||||.
  Fly    77 TAVSSATDRSNNNGNNHN-----PSLQLNGNGGSNTRQHSSGSNSRQHSSSSSNSNSSNISPPPS 136

  Fly   264 AIGSTSGDGSGGSISHKL---------RTLKFQPNCGEDGATKLHE-----FINNDLSQFLADNC 314
            :..|:..:.:..:.|..:         |:..|      ..||.:..     .||..:.:..:|:|
  Fly   137 SSSSSRSNNNNNNHSSNIISGFCSTIWRSATF------GSATPVINPLPAVSINPKIMESSSDSC 195

  Fly   315 VDGEAAAPQICLTD---------------------------------LPFEILLRILSYLDLKSL 346
            ....:..|.:.|.|                                 ||.|:|||:.||||:.||
  Fly   196 SLSSSTTPDVGLADQQRNMAGSAQDQSEDQSQTFLGATELDDELIKQLPKEVLLRVFSYLDVVSL 260

  Fly   347 FRVGHVSRTFYDISRHPLLYAEISLKPYWDVASSELLCTLARRAT-MLRKLDLSWCGGFGNVSPT 410
            .|...|.:.:..::.....:.:|:|..:.......::..:::|.. .|:.|.|..|...|:.|  
  Fly   261 CRCAQVCKYWNVLALDGSSWQKINLFDFQRDIEGPVIENISQRCRGFLKSLSLRGCQSVGDQS-- 323

  Fly   411 EFKKFLTQRGDNLTHLRLNSCKFLNASCIENVGIVCDNLIELSLRNCA--TEPPL--LNFSCLAN 471
              .:.|.....|:.||.|:.||.:.....:::...|..|..::|.:|:  |:..|  |:..|   
  Fly   324 --VRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDGC--- 383

  Fly   472 LKNLERLDLFQTYFETEL-LLSMLEGNRKLKHLNLAFCGVSVNMDNVAAHLATYNTQLISLDLWK 535
             .||..:::...:..:|. :.::..|..||:..:...| ..:| ||....||.|...|:.|:|..
  Fly   384 -PNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGC-KQIN-DNAIMCLAKYCPDLMVLNLHS 445

  Fly   536 AHFLSSRGLQSL-ARLHQLEELDLGWCMREASLGD-GLFQLLSNCPKLKKLFLSAVRGTTERDLM 598
            ...::...::.| |..|:|::|.:..|   |.|.| .|..|..:...|..|.:|..|..|:   :
  Fly   446 CETITDSSIRQLAANCHKLQKLCVSKC---ADLTDLTLLSLSQHNHLLNTLEVSGCRNFTD---I 504

  Fly   599 HIAALGKN---LEQLDLMGILNITHERVYDILVNCPKLQLLDLSFCDNIMD 646
            ...|||:|   ||::||.....||...:..:...||.|:.|.||.|:.|.|
  Fly   505 GFQALGRNCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITD 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 17/78 (22%)
leucine-rich repeat 393..422 CDD:275381 7/28 (25%)
leucine-rich repeat 423..442 CDD:275381 5/18 (28%)
LRR_RI 437..>641 CDD:238064 56/213 (26%)
leucine-rich repeat 449..474 CDD:275381 7/28 (25%)
leucine-rich repeat 475..499 CDD:275381 3/24 (13%)
leucine-rich repeat 500..527 CDD:275381 8/26 (31%)
leucine-rich repeat 528..552 CDD:275381 5/24 (21%)
AMN1 552..>660 CDD:187754 32/99 (32%)
leucine-rich repeat 553..580 CDD:275381 8/27 (30%)
leucine-rich repeat 581..606 CDD:275381 8/24 (33%)
leucine-rich repeat 607..632 CDD:275381 7/24 (29%)
leucine-rich repeat 633..652 CDD:275381 7/14 (50%)
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689 15/44 (34%)
leucine-rich repeat 280..307 CDD:275381 3/26 (12%)
AMN1 <308..453 CDD:187754 37/154 (24%)
leucine-rich repeat 308..327 CDD:275381 6/22 (27%)
leucine-rich repeat 334..359 CDD:275381 6/24 (25%)
leucine-rich repeat 360..385 CDD:275381 7/28 (25%)
leucine-rich repeat 386..411 CDD:275381 3/24 (13%)
AMN1 <409..586 CDD:187754 47/155 (30%)
leucine-rich repeat 412..437 CDD:275381 8/26 (31%)
leucine-rich repeat 438..463 CDD:275381 5/24 (21%)
leucine-rich repeat 464..515 CDD:275381 17/56 (30%)
leucine-rich repeat 516..541 CDD:275381 7/24 (29%)
leucine-rich repeat 542..561 CDD:275381 7/14 (50%)
leucine-rich repeat 571..595 CDD:275381
leucine-rich repeat 596..621 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457982
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.