DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and CG9316

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_610051.2 Gene:CG9316 / 35333 FlyBaseID:FBgn0032878 Length:448 Species:Drosophila melanogaster


Alignment Length:230 Identity:66/230 - (28%)
Similarity:92/230 - (40%) Gaps:32/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 LCTLARRATMLRKLDLSWCGGFGNVSPTEFKKFLTQRGDNLTHLRLNSCKF--LNASCIENVGIV 445
            ||......|::.:..|.|       :..||...|    .:|..|.|:.|.|  :|.|..:.:...
  Fly   202 LCGFPNLKTLVLRDCLLW-------NSMEFGIPL----KSLHTLDLDDCCFEVMNVSLYQKIAES 255

  Fly   446 CDNLIELSLRNCATEPPLLNFSCLANLKNLERLDLFQTYFETELLLSML------EGNRKLKHLN 504
            |.||:||....|.|     ||..:|||..|||..|.......||.:..|      .|| ||.||:
  Fly   256 CTNLVELIFSGCDT-----NFEVIANLPKLERCTLKTWMTSNELNIGFLTVLAEKRGN-KLTHLH 314

  Fly   505 LAFCGVSVNMDNVAAHLATYNTQLISLDLWKAHFLSSRGLQSLARLHQLEELDLGWCMREASLGD 569
            |:   ...|:.|..|......:.|..|.......|.....:....|.|||...|..|.|...:  
  Fly   315 LS---GQFNITNEHARCLGQLSSLTDLRFSNNDILDDDHFKFFNDLSQLERFGLTACGRVMDV-- 374

  Fly   570 GLFQLLSNCPKLKKLFLSAVRGTTERDLMHIAALG 604
            |:.::|..||:||.:.|:.....||..:  |.|:|
  Fly   375 GMMRMLRKCPQLKVIDLTDCEQITEEFV--IQAIG 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689
leucine-rich repeat 393..422 CDD:275381 5/28 (18%)
leucine-rich repeat 423..442 CDD:275381 7/20 (35%)
LRR_RI 437..>641 CDD:238064 52/174 (30%)
leucine-rich repeat 449..474 CDD:275381 10/24 (42%)
leucine-rich repeat 475..499 CDD:275381 9/29 (31%)
leucine-rich repeat 500..527 CDD:275381 7/26 (27%)
leucine-rich repeat 528..552 CDD:275381 4/23 (17%)
AMN1 552..>660 CDD:187754 18/53 (34%)
leucine-rich repeat 553..580 CDD:275381 8/26 (31%)
leucine-rich repeat 581..606 CDD:275381 8/24 (33%)
leucine-rich repeat 607..632 CDD:275381
leucine-rich repeat 633..652 CDD:275381
CG9316NP_610051.2 leucine-rich repeat 208..221 CDD:275381 3/19 (16%)
leucine-rich repeat 231..258 CDD:275381 8/26 (31%)
leucine-rich repeat 259..279 CDD:275381 10/24 (42%)
leucine-rich repeat 280..309 CDD:275381 9/29 (31%)
AMN1 310..>411 CDD:187754 29/105 (28%)
leucine-rich repeat 310..334 CDD:275381 7/26 (27%)
leucine-rich repeat 335..359 CDD:275381 4/23 (17%)
leucine-rich repeat 360..385 CDD:275381 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457961
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.