DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and fbxl14a

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_958890.1 Gene:fbxl14a / 333988 ZFINID:ZDB-GENE-030131-5920 Length:411 Species:Danio rerio


Alignment Length:410 Identity:107/410 - (26%)
Similarity:157/410 - (38%) Gaps:117/410 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 QICLTDLPFEILLRILSYLDLKSLFRVGHVSRTFYDISRHPLLYAEISLKPYWDVASSELLCTLA 387
            :|.::.|..|||..|.:|||:|...||..|...:.|.|.|..::..:..|.:...|:..|..:|.
Zfish     2 EIHISSLFPEILAMIFNYLDVKGKGRVAQVCTAWRDASYHKSVWRGVEAKLHLRRANPSLFPSLQ 66

  Fly   388 RRATM--------------------LRKLDLSWC-----GGFGNVSPTEFKKF------------ 415
            .|...                    :..|:||.|     .|.|:....:....            
Zfish    67 TRGIKKVQILSLRRSLSYVIQGMPNIESLNLSGCYNLTDNGLGHAFVQDIPSLRILNLSLCKQIT 131

  Fly   416 ------LTQRGDNLTHLRLNSCKFLNASCIENVGIV-----CDNLIELSLRNC------------ 457
                  :.|...||..|.|..|     |.|.|.|::     ..||..|:||:|            
Zfish   132 DSSLGRIAQYLKNLELLDLGGC-----SNITNTGLLLIAWGLHNLKSLNLRSCRHVSDVGIGHLA 191

  Fly   458 -----ATEPPLLNFSCLANLKNLERLDLFQTYFETELLLSML-EGNRKLKHLNLAFC-GVSVNMD 515
                 |.|      .||    .||.|.|......|:|.|..: :|..|||.|||:|| |:|   |
Zfish   192 GMTRSAAE------GCL----TLEHLTLQDCQKLTDLSLKHISKGLNKLKVLNLSFCGGIS---D 243

  Fly   516 NVAAHLATYNTQLISLDLWKAHFLSSRGLQSLA----RLHQLEELDLGWCMRE-----ASLGDGL 571
            ....|| ::.|||.:|:|.....:|..|:..|:    ||:   .||:.:|.:.     |.:..||
Zfish   244 AGMIHL-SHMTQLWTLNLRSCDNISDTGIMHLSMGALRLY---GLDVSFCDKVGDQSLAYIAQGL 304

  Fly   572 FQL--LSNCP----------------KLKKLFLSAVRGTTERDLMHIAALGKNLEQLDLMGILNI 618
            :||  ||.|.                :||.|.:......|::.|..||.....|..:||.|...|
Zfish   305 YQLKSLSLCSCHISDDGINRMVRQMHELKTLNIGQCVRITDKGLELIADHLTQLTGIDLYGCTKI 369

  Fly   619 THERVYDILVNCPKLQLLDL 638
            | :|..:.:...|.|::|:|
Zfish   370 T-KRGLERITQLPCLKVLNL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 15/45 (33%)
leucine-rich repeat 393..422 CDD:275381 7/51 (14%)
leucine-rich repeat 423..442 CDD:275381 6/18 (33%)
LRR_RI 437..>641 CDD:238064 74/253 (29%)
leucine-rich repeat 449..474 CDD:275381 9/41 (22%)
leucine-rich repeat 475..499 CDD:275381 8/24 (33%)
leucine-rich repeat 500..527 CDD:275381 12/27 (44%)
leucine-rich repeat 528..552 CDD:275381 8/27 (30%)
AMN1 552..>660 CDD:187754 29/110 (26%)
leucine-rich repeat 553..580 CDD:275381 11/49 (22%)
leucine-rich repeat 581..606 CDD:275381 7/24 (29%)
leucine-rich repeat 607..632 CDD:275381 7/24 (29%)
leucine-rich repeat 633..652 CDD:275381 3/6 (50%)
fbxl14aNP_958890.1 F-box-like 5..46 CDD:289689 15/40 (38%)
AMN1 90..243 CDD:187754 44/170 (26%)
leucine-rich repeat 92..118 CDD:275381 6/25 (24%)
leucine-rich repeat 119..144 CDD:275381 1/24 (4%)
leucine-rich repeat 145..170 CDD:275381 8/29 (28%)
leucine-rich repeat 171..203 CDD:275381 9/41 (22%)
leucine-rich repeat 204..229 CDD:275381 8/24 (33%)
AMN1 230..397 CDD:187754 51/167 (31%)
leucine-rich repeat 230..254 CDD:275381 12/27 (44%)
leucine-rich repeat 255..280 CDD:275381 6/24 (25%)
leucine-rich repeat 281..304 CDD:275381 5/25 (20%)
leucine-rich repeat 307..331 CDD:275381 4/23 (17%)
leucine-rich repeat 332..357 CDD:275381 7/24 (29%)
leucine-rich repeat 358..377 CDD:275381 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.