DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and CG15056

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster


Alignment Length:415 Identity:79/415 - (19%)
Similarity:138/415 - (33%) Gaps:156/415 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 LRILSYLDLKS---------LFRVGHVSRTFYDISR-----HPLLYAEISLKPYWDVASSEL--- 382
            |.:|..|||||         :|...:|..:...:||     ..:.::.:..|.:.:::.|::   
  Fly    17 LDVLKQLDLKSRISFAASCDMFENIYVRSSPLRLSRVVNLEEMIEFSLLETKLFVELSGSDIEII 81

  Fly   383 ---------------LCTLARRATMLRKLDLSWCGGFGNVSPTEFKKFLTQRG--DNLTHLRLNS 430
                           :..::.|.|.:.::.|.   ||   ..|::|.|.....  .|||::.|..
  Fly    82 RGGPHTPMFSHFEDFIRLMSIRLTKVNEIALE---GF---QLTQYKWFNAPETSFSNLTYVSLRR 140

  Fly   431 CKF------------------------LNASCIENVGIVCDNLIELSLRNCATEPP--LLNFSCL 469
            |:.                        |..||:.::.   .:|:.|.:..|....|  |:..:.:
  Fly   141 CQLNDENLVGWEFLTHLETLDLRYNDRLTGSCLMSLP---TSLLSLYITGCRNLCPNQLIFLNRI 202

  Fly   470 ANLKNLERLDL-----FQTYFETEL---LLSMLEGNRKLKHLNLAFCGVSVNMDNVAAHLATYNT 526
            ..|:.|...||     :..|.:..|   ||.|:|         ::.|  |:|.|........|..
  Fly   203 PRLRELRASDLMPGGHWHIYRDLVLACPLLVMVE---------ISIC--SLNRDEYRLGELRYLQ 256

  Fly   527 QLISLDLWKAH----------------------------------FLSSRGLQSLARLHQLEELD 557
            .|:.    |||                                  |:|:..|..::|..||..|.
  Fly   257 SLVI----KAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLK 317

  Fly   558 LGWCMREASLGDGLFQLLSNCPKLKKLFLSAVRGTTERDLMHIAALGKNLEQLDLMGILNITHER 622
                             :.|.|            ....||:.:..| ..||.|||.....||:|.
  Fly   318 -----------------MPNQP------------YRPNDLLRLRNL-TFLETLDLSNSPYITNEV 352

  Fly   623 VYDILVNCPKLQLLDLSFCDNIMDR 647
            |.::::..|.|.:|.:..|..:.:|
  Fly   353 VIELVIGIPNLSVLIVQGCPLLTNR 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 11/50 (22%)
leucine-rich repeat 393..422 CDD:275381 6/30 (20%)
leucine-rich repeat 423..442 CDD:275381 7/42 (17%)
LRR_RI 437..>641 CDD:238064 50/247 (20%)
leucine-rich repeat 449..474 CDD:275381 6/26 (23%)
leucine-rich repeat 475..499 CDD:275381 9/31 (29%)
leucine-rich repeat 500..527 CDD:275381 5/26 (19%)
leucine-rich repeat 528..552 CDD:275381 8/57 (14%)
AMN1 552..>660 CDD:187754 22/96 (23%)
leucine-rich repeat 553..580 CDD:275381 3/26 (12%)
leucine-rich repeat 581..606 CDD:275381 3/24 (13%)
leucine-rich repeat 607..632 CDD:275381 9/24 (38%)
leucine-rich repeat 633..652 CDD:275381 4/15 (27%)
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 4/22 (18%)
leucine-rich repeat 157..179 CDD:275381 3/24 (13%)
leucine-rich repeat 180..204 CDD:275381 5/23 (22%)
leucine-rich repeat 205..231 CDD:275381 6/25 (24%)
leucine-rich repeat 232..285 CDD:275381 12/67 (18%)
leucine-rich repeat 286..326 CDD:275381 9/68 (13%)
AMN1 306..>376 CDD:187754 22/99 (22%)
leucine-rich repeat 337..362 CDD:275381 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457999
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.