Sequence 1: | NP_572951.1 | Gene: | Fbxl4 / 32378 | FlyBaseID: | FBgn0030555 | Length: | 669 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001296447.1 | Gene: | fbxl6 / 323163 | ZFINID: | ZDB-GENE-060810-162 | Length: | 564 | Species: | Danio rerio |
Alignment Length: | 402 | Identity: | 84/402 - (20%) |
---|---|---|---|
Similarity: | 139/402 - (34%) | Gaps: | 143/402 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 329 LPFEILLRILSYLDLKS-----LFRVGHVSRTFYDISRHPLLYAEISLKPYW-DVASSELLCT-- 385
Fly 386 --------LA-RRATMLRKLDLSWCGGFGNVSPTEFKKFLTQRGDNLTHLRLNSCKFLNASCIEN 441
Fly 442 VGIVCDNLIELSLRNCATEPPLLNFSCLANLKNLERLDLFQTYFETELLLSMLEGNRKLKHLNLA 506
Fly 507 FCGVSVNMDNVAAHLATYNTQLISLDLWKAHFL----SSRGLQSLAR-----LHQLE---ELDLG 559
Fly 560 W-----CMREASLGDGLFQLLSNCPKLKKLFLSAVRGT--------------------------- 592
Fly 593 ---TERDLMHIAALGKNLEQLDLMGILNITHERVYDILVNCPKLQLL--DLSFCDNIM---DRDF 649
Fly 650 DLLAE-WSRQFK 660 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fbxl4 | NP_572951.1 | F-box-like | 326..372 | CDD:289689 | 15/47 (32%) |
leucine-rich repeat | 393..422 | CDD:275381 | 8/28 (29%) | ||
leucine-rich repeat | 423..442 | CDD:275381 | 4/18 (22%) | ||
LRR_RI | 437..>641 | CDD:238064 | 43/252 (17%) | ||
leucine-rich repeat | 449..474 | CDD:275381 | 1/24 (4%) | ||
leucine-rich repeat | 475..499 | CDD:275381 | 0/23 (0%) | ||
leucine-rich repeat | 500..527 | CDD:275381 | 4/26 (15%) | ||
leucine-rich repeat | 528..552 | CDD:275381 | 6/32 (19%) | ||
AMN1 | 552..>660 | CDD:187754 | 35/151 (23%) | ||
leucine-rich repeat | 553..580 | CDD:275381 | 8/34 (24%) | ||
leucine-rich repeat | 581..606 | CDD:275381 | 6/54 (11%) | ||
leucine-rich repeat | 607..632 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 633..652 | CDD:275381 | 5/23 (22%) | ||
fbxl6 | NP_001296447.1 | F-box-like | 147..195 | CDD:289689 | 14/46 (30%) |
AMN1 | 213..396 | CDD:187754 | 43/253 (17%) | ||
leucine-rich repeat | 229..254 | CDD:275381 | 8/28 (29%) | ||
leucine-rich repeat | 255..280 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 281..306 | CDD:275381 | 5/77 (6%) | ||
leucine-rich repeat | 307..334 | CDD:275381 | 5/26 (19%) | ||
leucine-rich repeat | 335..362 | CDD:275381 | 8/35 (23%) | ||
AMN1 | <391..>542 | CDD:187754 | 22/88 (25%) | ||
leucine-rich repeat | 391..418 | CDD:275381 | 3/26 (12%) | ||
leucine-rich repeat | 419..438 | CDD:275381 | 8/20 (40%) | ||
leucine-rich repeat | 445..473 | CDD:275381 | 7/27 (26%) | ||
leucine-rich repeat | 475..505 | CDD:275381 | 0/2 (0%) | ||
leucine-rich repeat | 506..530 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |