DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and fbxl6

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001296447.1 Gene:fbxl6 / 323163 ZFINID:ZDB-GENE-060810-162 Length:564 Species:Danio rerio


Alignment Length:402 Identity:84/402 - (20%)
Similarity:139/402 - (34%) Gaps:143/402 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 LPFEILLRILSYLDLKS-----LFRVGHVSRTFYDISRHPLLYAEISLKPYW-DVASSELLCT-- 385
            ||.|||::|..:...:.     |.|||.|.|.:...:..|:|:..:|:...| :...|:|..|  
Zfish   148 LPLEILVKIFQFAVFQDGAVPLLCRVGRVCRLWNGAASSPILWRSVSIGYCWIEPGKSQLPGTEQ 212

  Fly   386 --------LA-RRATMLRKLDLSWCGGFGNVSPTEFKKFLTQRGDNLTHLRLNSCKFLNASCIEN 441
                    || .|...||:..|  |....||.....|  ::|...:|..|:|:.|..:.....:|
Zfish   213 KIKNTVDWLAENRLFQLREFSL--CHWKKNVDYVIQK--VSQSCLSLHSLKLSYCTGMTEKAFQN 273

  Fly   442 VGIVCDNLIELSLRNCATEPPLLNFSCLANLKNLERLDLFQTYFETELLLSMLEGNRKLKHLNLA 506
            :|..|.:|.::::::.                                                 
Zfish   274 LGADCQSLEDINVQHS------------------------------------------------- 289

  Fly   507 FCGVSVNMDNVAAHLATYNTQLISLDLWKAHFL----SSRGLQSLAR-----LHQLE---ELDLG 559
                .:|:|.:.:.|..|..|     :.|.:|.    |.:.|.:|::     |..||   :||.|
Zfish   290 ----EINVDGLVSFLEAYGNQ-----IKKIYFTHSTKSDKLLSALSKGCCPELRLLEINTKLDGG 345

  Fly   560 W-----CMREASLGDGLFQLLSNCPKLKKLFLSAVRGT--------------------------- 592
            :     |::...:|         ||||:...|..|...                           
Zfish   346 YSQLPICIQGLQIG---------CPKLQTFRLMNVTAVPKMIRNIPSSTCGFPMLEELCIATSFH 401

  Fly   593 ---TERDLMHIAALGKNLEQLDLMGILNITHERVYDILVNCPKLQLL--DLSFCDNIM---DRDF 649
               |:.||.::.....||..|||.|...||...:|  .:.|.:|:..  .|.|..|.|   .:..
Zfish   402 SFMTDNDLNNVLHGSPNLRVLDLRGGSRITPTGLY--ALPCERLECFYWGLYFNSNTMVASKKGI 464

  Fly   650 DLLAE-WSRQFK 660
            .:||: ||...:
Zfish   465 HMLAQKWSNTLR 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 15/47 (32%)
leucine-rich repeat 393..422 CDD:275381 8/28 (29%)
leucine-rich repeat 423..442 CDD:275381 4/18 (22%)
LRR_RI 437..>641 CDD:238064 43/252 (17%)
leucine-rich repeat 449..474 CDD:275381 1/24 (4%)
leucine-rich repeat 475..499 CDD:275381 0/23 (0%)
leucine-rich repeat 500..527 CDD:275381 4/26 (15%)
leucine-rich repeat 528..552 CDD:275381 6/32 (19%)
AMN1 552..>660 CDD:187754 35/151 (23%)
leucine-rich repeat 553..580 CDD:275381 8/34 (24%)
leucine-rich repeat 581..606 CDD:275381 6/54 (11%)
leucine-rich repeat 607..632 CDD:275381 9/24 (38%)
leucine-rich repeat 633..652 CDD:275381 5/23 (22%)
fbxl6NP_001296447.1 F-box-like 147..195 CDD:289689 14/46 (30%)
AMN1 213..396 CDD:187754 43/253 (17%)
leucine-rich repeat 229..254 CDD:275381 8/28 (29%)
leucine-rich repeat 255..280 CDD:275381 7/24 (29%)
leucine-rich repeat 281..306 CDD:275381 5/77 (6%)
leucine-rich repeat 307..334 CDD:275381 5/26 (19%)
leucine-rich repeat 335..362 CDD:275381 8/35 (23%)
AMN1 <391..>542 CDD:187754 22/88 (25%)
leucine-rich repeat 391..418 CDD:275381 3/26 (12%)
leucine-rich repeat 419..438 CDD:275381 8/20 (40%)
leucine-rich repeat 445..473 CDD:275381 7/27 (26%)
leucine-rich repeat 475..505 CDD:275381 0/2 (0%)
leucine-rich repeat 506..530 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.