DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and Fbxl17

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_038939705.1 Gene:Fbxl17 / 316663 RGDID:1309773 Length:739 Species:Rattus norvegicus


Alignment Length:450 Identity:87/450 - (19%)
Similarity:154/450 - (34%) Gaps:156/450 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 PPPD-------------AIGSTSGDG--SGGSISHKLRTLKFQPNCGEDGATKLHEFINNDLSQF 309
            |||.             .|.:.:||.  :||:.....:.   ||..|:           :|..:.
  Rat   248 PPPPLCPAPASPASECAPIEAAAGDAVRAGGTAPSSAQQ---QPESGD-----------SDCQEP 298

  Fly   310 LADNCVDGEAAAPQI-CLTDLPFEILLRILSYLDLKSLFRVGHVSRTFYDISRHPLLYAEISLKP 373
            ..:.|.......|:| .:..||..|||:|.|.|.|.                 ...|.|.:..| 
  Rat   299 PENPCDCHREPPPEIPDINQLPPSILLKIFSNLSLD-----------------ERCLSASLVCK- 345

  Fly   374 YWDVASSELLCTLARRATMLRKLDLSWCGGFGNVSPT-EFKKFLTQRGDNLTHLRLNSCKFLNAS 437
            ||.        .|.......::||||     .....| |..:.:..|..|:..:.::.|:.::.|
  Rat   346 YWR--------DLCLDFQFWKQLDLS-----SRQQVTDELLEKIASRSQNIVEINISDCRSMSDS 397

  Fly   438 CIENVGIVCDNLIELSLRNCATEPPLLNFSCLANLKNLERLDLFQTYFETELLLSMLEGNRKLKH 502
            .:..:...|..|:..:...|               |.|.         :|.::.           
  Rat   398 GVCVLAFKCPGLLRYTAYRC---------------KQLS---------DTSIIA----------- 427

  Fly   503 LNLAFCGVSVNMDNVAAHLATYNTQLISLDLWKAHF-----LSSRGLQSL-ARLHQLEELDLGWC 561
                          ||:|...         |.|.|.     |:..||:.| ::..:|:::..|.|
  Rat   428 --------------VASHCPL---------LQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQC 469

  Fly   562 MREASLGDGLFQLLSNCPKLKKLFLSAVRGTTER----------DLMHIAALG------------ 604
            .:.:.  :|:..:..:|.||:::::...:..|::          ||..:..:|            
  Rat   470 YKISD--EGMVVIAKSCLKLQRIYMQENKLVTDQSVKAFAEHCPDLQCVGFMGCSVTSKGVIHLT 532

  Fly   605 --KNLEQLDLMGILNITHERVYDILVNCPKLQLLDLSFCDN--IMDRDFDLLAEWSRQFK 660
              :||..|||..|..:.:|.|.:|:..|..|..|:|  |.|  |.||..:::|:..:..|
  Rat   533 KLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNL--CLNWIINDRCVEVIAKEGQSLK 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 11/45 (24%)
leucine-rich repeat 393..422 CDD:275381 7/29 (24%)
leucine-rich repeat 423..442 CDD:275381 2/18 (11%)
LRR_RI 437..>641 CDD:238064 41/233 (18%)
leucine-rich repeat 449..474 CDD:275381 2/24 (8%)
leucine-rich repeat 475..499 CDD:275381 2/23 (9%)
leucine-rich repeat 500..527 CDD:275381 3/26 (12%)
leucine-rich repeat 528..552 CDD:275381 7/29 (24%)
AMN1 552..>660 CDD:187754 30/133 (23%)
leucine-rich repeat 553..580 CDD:275381 5/26 (19%)
leucine-rich repeat 581..606 CDD:275381 5/48 (10%)
leucine-rich repeat 607..632 CDD:275381 9/24 (38%)
leucine-rich repeat 633..652 CDD:275381 8/20 (40%)
Fbxl17XP_038939705.1 F-box-like 316..361 CDD:403981 15/70 (21%)
leucine-rich repeat 357..382 CDD:275381 7/29 (24%)
leucine-rich repeat 383..408 CDD:275381 3/24 (13%)
AMN1 406..568 CDD:187754 39/221 (18%)
leucine-rich repeat 409..434 CDD:275381 8/73 (11%)
leucine-rich repeat 435..460 CDD:275381 7/24 (29%)
leucine-rich repeat 461..486 CDD:275381 5/26 (19%)
leucine-rich repeat 487..512 CDD:275381 2/24 (8%)
leucine-rich repeat 513..536 CDD:275381 2/22 (9%)
leucine-rich repeat 537..562 CDD:275381 9/24 (38%)
leucine-rich repeat 563..588 CDD:275381 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.