DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and Fbxl21

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_038951543.1 Gene:Fbxl21 / 306750 RGDID:1305555 Length:460 Species:Rattus norvegicus


Alignment Length:372 Identity:82/372 - (22%)
Similarity:120/372 - (32%) Gaps:132/372 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 LPFEILLRILSYLDLKSLFRVGHVSRTFYDI-----------------------SRHPLLYAEI- 369
            ||..::|||..||.|....|...|.|::.::                       |.||.|..:| 
  Rat    71 LPHHVILRIFQYLPLVDRARASSVCRSWNEVFHIPDLWRKFEFELNQSATSYFKSTHPDLIQQII 135

  Fly   370 ----------SLKPYWDVASSELLCTLARRATMLRKLDLSWCG-------GFGNVSPTEFKKFLT 417
                      |.|......|:|..|.:   .:.|....:...|       .|.|:..:.|...||
  Rat   136 KKHAAHLQYVSFKVDSSTESAEAACHI---LSQLVNCSIQTLGLISTAKPSFMNMPKSHFVSALT 197

  Fly   418 -----------------------------QRGDNLTHLRLNSCKFLNASCIENVGIVCDNLIELS 453
                                         ...|.|..|:::||..:::..|..|...|..|.||:
  Rat   198 VVFVNSKSLSSIKIEDTPVDDPSLKILVANNSDTLRLLKMSSCPHVSSDGILCVADHCQGLRELA 262

  Fly   454 LRNCATEPPLLNFSCLANLKNLERLDLFQTYFETELLLSM-LEGNRKLKHLNLAFCGVSVNMDNV 517
                      ||:..|::                ||||:: .|.:..|:||.:..  ||.|...:
  Rat   263 ----------LNYYILSD----------------ELLLALSSETHVNLEHLRIDV--VSENPGQI 299

  Fly   518 AAHLATYNTQLISLDLWKAHFLSSRGLQSLARLHQLEE--------------LDLGWCMREASLG 568
            ..|       .|....|.|....|.|:..:......||              |..|..:....||
  Rat   300 KFH-------SIKKPSWDALVKHSPGVNVVMYFFLYEEEFDTFFKEETPVTHLYFGRSVSRTILG 357

  Fly   569 D-GLFQLLSNCPKLKKLFLSAVRG--TTERDLMHIAALGKNLEQLDL 612
            . ||     |||:|.:|.:.| .|  ..:.:|:.||...|||..|.|
  Rat   358 RIGL-----NCPRLIELVVCA-NGLQPLDSELIRIAEHCKNLTALGL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 17/76 (22%)
leucine-rich repeat 393..422 CDD:275381 7/64 (11%)
leucine-rich repeat 423..442 CDD:275381 5/18 (28%)
LRR_RI 437..>641 CDD:238064 49/194 (25%)
leucine-rich repeat 449..474 CDD:275381 6/24 (25%)
leucine-rich repeat 475..499 CDD:275381 5/24 (21%)
leucine-rich repeat 500..527 CDD:275381 7/26 (27%)
leucine-rich repeat 528..552 CDD:275381 5/23 (22%)
AMN1 552..>660 CDD:187754 23/78 (29%)
leucine-rich repeat 553..580 CDD:275381 10/41 (24%)
leucine-rich repeat 581..606 CDD:275381 7/26 (27%)
leucine-rich repeat 607..632 CDD:275381 3/6 (50%)
leucine-rich repeat 633..652 CDD:275381
Fbxl21XP_038951543.1 F-box-like 68..111 CDD:403981 11/39 (28%)
leucine-rich repeat 206..231 CDD:275381 0/24 (0%)
leucine-rich repeat 232..257 CDD:275381 7/24 (29%)
leucine-rich repeat 258..283 CDD:275381 11/50 (22%)
leucine-rich repeat 284..318 CDD:275381 11/42 (26%)
leucine-rich repeat 329..365 CDD:275381 10/40 (25%)
AMN1 <359..>424 CDD:187754 17/46 (37%)
leucine-rich repeat 366..392 CDD:275381 7/26 (27%)
leucine-rich repeat 393..418 CDD:275381 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.