DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Fbxl4 and FBXL22

DIOPT Version :9

Sequence 1:	NP_572951.1	Gene:	Fbxl4 / 32378	FlyBaseID:	FBgn0030555	Length:	669	Species:	Drosophila melanogaster
Sequence 2:	XP_011519770.1	Gene:	FBXL22 / 283807	HGNCID:	27537	Length:	260	Species:	Homo sapiens

Alignment Length:	121	Identity:	34/121 - (28%)
Similarity:	53/121 - (43%)	Gaps:	7/121 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   515 DNVAAHLATYNTQLISLDLWKAHFLSSRGLQSLARLHQLEELDLGWCMREASLGDGLFQLLSNCP 579
            :|..|...|:|..:.|    :....:|:| .|..|...|..:.|..|.....  |.|.:||..||
Human   118 ENGPARKPTWNPAVSS----QPSVFTSQG-PSPPRCPNLASVTLSGCGHVTD--DCLARLLRCCP 175

  Fly   580 KLKKLFLSAVRGTTERDLMHIAALGKNLEQLDLMGILNITHERVYDILVNCPKLQL 635
            :|:.|.|......|.|.|..:||.|:.|:.|.:....|::...:..:...||:|.|
Human   176 RLRALRLENCARVTNRTLAAVAADGRALQTLHVDFCRNVSAAGLRRLRAACPRLAL 231

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Fbxl4	NP_572951.1	F-box-like	326..372	CDD:289689
		leucine-rich repeat	393..422	CDD:275381
		leucine-rich repeat	423..442	CDD:275381
		LRR_RI	437..>641	CDD:238064	34/121 (28%)
		leucine-rich repeat	449..474	CDD:275381
		leucine-rich repeat	475..499	CDD:275381
		leucine-rich repeat	500..527	CDD:275381	4/11 (36%)
		leucine-rich repeat	528..552	CDD:275381	5/23 (22%)
		AMN1	552..>660	CDD:187754	25/84 (30%)
		leucine-rich repeat	553..580	CDD:275381	8/26 (31%)
		leucine-rich repeat	581..606	CDD:275381	9/24 (38%)
		leucine-rich repeat	607..632	CDD:275381	4/24 (17%)
		leucine-rich repeat	633..652	CDD:275381	2/3 (67%)
FBXL22	XP_011519770.1	AMN1	<148..229	CDD:187754	23/82 (28%)
		leucine-rich repeat	151..176	CDD:275381	8/26 (31%)
		leucine-rich repeat	177..202	CDD:275381	9/24 (38%)
		leucine-rich repeat	203..228	CDD:275381	4/24 (17%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1947
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900