DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and FBXL3

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_036290.1 Gene:FBXL3 / 26224 HGNCID:13599 Length:428 Species:Homo sapiens


Alignment Length:457 Identity:95/457 - (20%)
Similarity:155/457 - (33%) Gaps:126/457 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 DAIGSTSGDGSGGSISHKLRTL-KFQPNCGEDGATKLHEFINNDLSQFLADNCVDGEAAAPQIC- 325
            |:..::|.:|:... |.||||. :....|  |....|.:.|   |..|.....:| .|.|.|:| 
Human     7 DSDRNSSEEGTAEK-SKKLRTTNEHSQTC--DWGNLLQDII---LQVFKYLPLLD-RAHASQVCR 64

  Fly   326 -------LTDL----PFEILLRILSYLDLKSLFRVGHVSRTFYDISRHPLLYAEISLKPYWDVAS 379
                   :.||    .||:.....|||      :..|.......|.||......:|.|......|
Human    65 NWNQVFHMPDLWRCFEFELNQPATSYL------KATHPELIKQIIKRHSNHLQYVSFKVDSSKES 123

  Fly   380 SELLCTLARRATMLRKLDLSWCGGFGNVSPT---------------------------------- 410
            :|..|.:   .:.|....|...|......|:                                  
Human   124 AEAACDI---LSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVD 185

  Fly   411 --EFKKFLTQRGDNLTHLRLNSCKFLNASCIENVGIVCDNLIELSLRNCATEPPLLNFSCLANLK 473
              ..|..:....|.|..|:::||..::.:.|..|...|..|.||:          ||:..|::  
Human   186 DPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELA----------LNYHLLSD-- 238

  Fly   474 NLERLDLFQTYFETELLLSM-LEGNRKLKHLNLAFCGVSVNMDNVAAHLATYNTQLISLDLWKAH 537
                          ||||:: .|.:.:|:||.:         |.|:.:....:...|....|.|.
Human   239 --------------ELLLALSSEKHVRLEHLRI---------DVVSENPGQTHFHTIQKSSWDAF 280

  Fly   538 FLSSRGLQSLARLHQLEE--------------LDLGWCMREASLGDGLFQLLSNCPKLKKLFLSA 588
            ...|..:..:......||              |..|..:.:..||    ::...||:|.:|.:.|
Human   281 IRHSPKVNLVMYFFLYEEEFDPFFRYEIPATHLYFGRSVSKDVLG----RVGMTCPRLVELVVCA 341

  Fly   589 --VRGTTERDLMHIAALGKNLEQLDLMGILNITHERVYDILVNCPKLQLLDLSFCDNIM--DRDF 649
              :|...| :|:.||...|||..:.| |...::.....:.:..|.. :|..||..:.::  |:.:
Human   342 NGLRPLDE-ELIRIAERCKNLSAIGL-GECEVSCSAFVEFVKMCGG-RLSQLSIMEEVLIPDQKY 403

  Fly   650 DL 651
            .|
Human   404 SL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 12/49 (24%)
leucine-rich repeat 393..422 CDD:275381 5/64 (8%)
leucine-rich repeat 423..442 CDD:275381 5/18 (28%)
LRR_RI 437..>641 CDD:238064 48/220 (22%)
leucine-rich repeat 449..474 CDD:275381 6/24 (25%)
leucine-rich repeat 475..499 CDD:275381 5/24 (21%)
leucine-rich repeat 500..527 CDD:275381 5/26 (19%)
leucine-rich repeat 528..552 CDD:275381 4/23 (17%)
AMN1 552..>660 CDD:187754 27/118 (23%)
leucine-rich repeat 553..580 CDD:275381 7/40 (18%)
leucine-rich repeat 581..606 CDD:275381 8/26 (31%)
leucine-rich repeat 607..632 CDD:275381 4/24 (17%)
leucine-rich repeat 633..652 CDD:275381 5/21 (24%)
FBXL3NP_036290.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 7/20 (35%)
F-box-like 36..77 CDD:403981 11/44 (25%)
LRR 1 119..146 6/29 (21%)
leucine-rich repeat 174..199 CDD:275381 1/24 (4%)
LRR 2 181..207 4/25 (16%)
leucine-rich repeat 200..225 CDD:275381 7/24 (29%)
LRR 3 208..233 8/34 (24%)
LRR 4 234..259 9/49 (18%)
leucine-rich repeat 252..286 CDD:275381 9/42 (21%)
leucine-rich repeat 287..333 CDD:275381 7/49 (14%)
LRR 5 316..341 7/28 (25%)
leucine-rich repeat 334..360 CDD:275381 8/26 (31%)
LRR 6 343..368 9/26 (35%)
leucine-rich repeat 361..383 CDD:275381 3/22 (14%)
LRR 7 369..394 4/25 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.