Sequence 1: | NP_572951.1 | Gene: | Fbxl4 / 32378 | FlyBaseID: | FBgn0030555 | Length: | 669 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001106895.1 | Gene: | Amn1 / 232566 | MGIID: | 2442933 | Length: | 258 | Species: | Mus musculus |
Alignment Length: | 245 | Identity: | 67/245 - (27%) |
---|---|---|---|
Similarity: | 120/245 - (48%) | Gaps: | 31/245 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 428 LNSCKFLNASCIENVGIVCDNLIE-LSLRNCATEPPLLNFSCLANLKNLERLDLFQTYFETELLL 491
Fly 492 SMLEGNRKLKHLNLAFCGV---SVNMDNVAAHLATYNTQLISLDLWKAHFLSSRGLQSLA-RLHQ 552
Fly 553 LEELDLGWCMREASLGDGLFQLLSNCPKLKKLFLSAVRGTTERDLMHIAAL-----GKNLEQLDL 612
Fly 613 MGILNITHERVYDILVNCPKLQLLDLSFCDNIMDRDFDLLAE--WSRQFK 660 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fbxl4 | NP_572951.1 | F-box-like | 326..372 | CDD:289689 | |
leucine-rich repeat | 393..422 | CDD:275381 | |||
leucine-rich repeat | 423..442 | CDD:275381 | 2/13 (15%) | ||
LRR_RI | 437..>641 | CDD:238064 | 57/213 (27%) | ||
leucine-rich repeat | 449..474 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 475..499 | CDD:275381 | 6/23 (26%) | ||
leucine-rich repeat | 500..527 | CDD:275381 | 9/29 (31%) | ||
leucine-rich repeat | 528..552 | CDD:275381 | 5/24 (21%) | ||
AMN1 | 552..>660 | CDD:187754 | 33/114 (29%) | ||
leucine-rich repeat | 553..580 | CDD:275381 | 9/26 (35%) | ||
leucine-rich repeat | 581..606 | CDD:275381 | 6/29 (21%) | ||
leucine-rich repeat | 607..632 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 633..652 | CDD:275381 | 5/18 (28%) | ||
Amn1 | NP_001106895.1 | leucine-rich repeat | 15..38 | CDD:275381 | 2/18 (11%) |
AMN1 | 37..257 | CDD:187754 | 65/227 (29%) | ||
leucine-rich repeat | 63..86 | CDD:275381 | 6/23 (26%) | ||
leucine-rich repeat | 87..116 | CDD:275381 | 9/29 (31%) | ||
leucine-rich repeat | 117..142 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 143..168 | CDD:275381 | 9/26 (35%) | ||
leucine-rich repeat | 169..195 | CDD:275381 | 6/29 (21%) | ||
leucine-rich repeat | 196..221 | CDD:275381 | 7/24 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |