DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and Kdm2a

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001001984.2 Gene:Kdm2a / 225876 MGIID:1354736 Length:1161 Species:Mus musculus


Alignment Length:464 Identity:98/464 - (21%)
Similarity:151/464 - (32%) Gaps:151/464 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 EATESDLSRPPPLDSRRFAPSLKKTTMLTKTLRIDFNHSRLNYYTEIDAIMLCGRT-VTKTQNLL 245
            :|||..:.|     .:...||.||.  |::..:.....|.|....:.....|.|.: |.|.|.:.
Mouse   766 QATERTMVR-----EKENNPSGKKE--LSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAIT 823

  Fly   246 AKQ-QITQHSRTLVSPPPDAIGSTSGDGSG-GSISHKLRTLKFQPNCGEDGATKLHEFINNDLSQ 308
            |.. .:..:.|.|:...| |.....||..| |....:....:...:..|.||.:|:.  ....:|
Mouse   824 ASSANLRPNPRVLMQHCP-ARNPQHGDEEGLGGEEEEEEEEEEDDSAEEGGAARLNG--RGSWAQ 885

  Fly   309 FLADNCVDGEAAAPQICLTDLPFEILLRILSYLDLKSLFRVGHVSRTFY------------DISR 361
                   ||:.:..|       .|:.:.:..||..|.|.....|.:|:|            |:||
Mouse   886 -------DGDESWMQ-------REVWMSVFRYLSRKELCECMRVCKTWYKWCCDKRLWTKIDLSR 936

  Fly   362 HPLLYAE----------ISLKPYWDVASSELLCTLARR------------------------ATM 392
            ...:..:          :||...|...|.:.|..|..|                        ..:
Mouse   937 CKAIVPQALSGIIKRQPVSLDLSWTNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPL 1001

  Fly   393 LRKLDLSWCGGFGNVSPTEFKKFLTQRGD-----------NLTHLRLNSCKFLNASCIENVGI-V 445
            ||.|||.|..|   :...:.:..||...|           |:|..||             .|: :
Mouse  1002 LRTLDLRWAVG---IKDPQIRDLLTPPTDKPGQDNRSKLRNMTDFRL-------------AGLDI 1050

  Fly   446 CDNLIELSLRNCATEPPLLNFSCLANLKNLERLDLFQ----TYFETELLLSMLEGNR-KLKHLNL 505
            .|..:.|.:|:.    |||:           ||||..    |...:.||.::....| .|..||:
Mouse  1051 TDATLRLIIRHM----PLLS-----------RLDLSHCSHLTDQSSNLLTAVGSSTRYSLTELNM 1100

  Fly   506 AFCGVSVN-----MDNVAAHLATYNTQLISLDLWK-------AHFLSSRGLQSLARLHQLEELDL 558
            |.|....:     :..:|      |..||.|...|       .||:|...:.||           
Mouse  1101 AGCNKLTDQTLFFLRRIA------NVTLIDLRGCKQITRKACEHFISDLSINSL----------- 1148

  Fly   559 GWCMREASL 567
             :|:.:..|
Mouse  1149 -YCLSDEKL 1156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 12/67 (18%)
leucine-rich repeat 393..422 CDD:275381 10/39 (26%)
leucine-rich repeat 423..442 CDD:275381 3/18 (17%)
LRR_RI 437..>641 CDD:238064 33/149 (22%)
leucine-rich repeat 449..474 CDD:275381 5/24 (21%)
leucine-rich repeat 475..499 CDD:275381 8/28 (29%)
leucine-rich repeat 500..527 CDD:275381 7/31 (23%)
leucine-rich repeat 528..552 CDD:275381 9/30 (30%)
AMN1 552..>660 CDD:187754 2/16 (13%)
leucine-rich repeat 553..580 CDD:275381 2/15 (13%)
leucine-rich repeat 581..606 CDD:275381
leucine-rich repeat 607..632 CDD:275381
leucine-rich repeat 633..652 CDD:275381
Kdm2aNP_001001984.2 cupin_like 199..299 CDD:389752
JHD 304..>339 CDD:375347
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..445
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..557
zf-CXXC <576..609 CDD:366873
PHD_KDM2A 619..675 CDD:277113
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 705..789 9/29 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 840..886 11/55 (20%)
F-box-like 895..933 CDD:372399 8/37 (22%)
leucine-rich repeat 929..953 CDD:275381 3/23 (13%)
AMN1 931..1137 CDD:187754 50/242 (21%)
leucine-rich repeat 954..977 CDD:275381 7/22 (32%)
LRR 1 960..981 5/20 (25%)
leucine-rich repeat 978..1001 CDD:275381 0/22 (0%)
LRR 2 983..1009 5/25 (20%)
leucine-rich repeat 1002..1039 CDD:275381 10/39 (26%)
leucine-rich repeat 1040..1064 CDD:275381 7/40 (18%)
LRR 3 1047..1072 11/39 (28%)
leucine-rich repeat 1065..1094 CDD:275381 9/39 (23%)
LRR 4 1073..1102 7/28 (25%)
leucine-rich repeat 1095..1119 CDD:275381 6/29 (21%)
LRR 5 1103..1127 6/29 (21%)
leucine-rich repeat 1120..1139 CDD:275381 4/18 (22%)
LRR 6 1128..1155 7/38 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.