DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and Fbxl16

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001366323.1 Gene:Fbxl16 / 214931 MGIID:2448488 Length:575 Species:Mus musculus


Alignment Length:545 Identity:114/545 - (20%)
Similarity:183/545 - (33%) Gaps:176/545 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 PGAVVRIWAYGLTKNWTCLWEATESDLSRPPPLDSRRFAPSLKKTTMLTKTLRIDFNHSRLNYYT 226
            ||....:.|..:||.    ..|.::...:|||      .|:|...::.|...|            
Mouse   120 PGQPNGLGAASITKG----TPAAKNRPCQPPP------PPTLPPPSLATPLSR------------ 162

  Fly   227 EIDAIMLCGRTVTKTQNLLAKQQITQHSRTLVSPPPDAIGSTSGDGSG----------------- 274
                :.|.|                       .|.|.|.|..||..||                 
Mouse   163 ----VALAG-----------------------GPCPPASGPASGPVSGPPVERPPLATDEKILNG 200

  Fly   275 -------------GSISHKLRTLKFQPNCGEDGATKLH-------------EFINNDLSQFLADN 313
                         ..:....|.:.:||.........||             ||:|  |..|.|..
Mouse   201 LFWYFSACEKCILAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVN--LQGFAARG 263

  Fly   314 ----CVDGEAAAPQICLTDLPFEILLRILSYLDLKSLFRVGHVSRTFYDISRHPLLYA--EISLK 372
                |:.|        ::||.      |..::|..||.:.|..:.:   :.|..:..|  |:.|:
Mouse   264 FEGFCLVG--------VSDLD------ICEFIDNYSLSKKGVKAMS---LKRSTITDAGLEVMLE 311

  Fly   373 PYWDVASSELLCTLARRATMLRKLDLSWCGGFGNVSPTEFKKFLTQRG------DNLTHLRLNSC 431
            ....|.                :|:||.|..|            |:.|      ..:|.|.::.|
Mouse   312 QMQGVV----------------RLELSGCNDF------------TEAGLWSSLSARITSLSVSDC 348

  Fly   432 KFLNASCIENVGIVCDNLIELSLRNC-ATEPPLLNFSCLA--NLKNLERLDLFQTYFETELLLSM 493
            ..:....|..:..:..||.||||:.. .|:..|..|:...  :...|..|..::  .....::::
Mouse   349 INVADDAIAAISQLLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLRLLSCWE--ITNHGVVNV 411

  Fly   494 LEGNRKLKHLNLAFC------GVSVNMDNVAAHLATYNTQLISLDLWKAHFLSSRGLQSLA-RLH 551
            :.....|..|:|:.|      ||.:..:|:        .:|.||||.....::...|:.:| .||
Mouse   412 VHSLPNLTSLSLSGCSKVTDDGVELVAENL--------RKLRSLDLSWCPRITDMALEYVACDLH 468

  Fly   552 QLEELDLGWCMREASLGDGLFQLLSNCPKLKKLFLSAVRGTTERDLMHIAALGKNLEQLDLMGIL 616
            :||||.|..|:|....|   ...||....|:.|:|.......:..|.|:.|: :||..|.|.|..
Mouse   469 RLEELVLDRCVRITDTG---LSYLSTMSSLRSLYLRWCCQVQDFGLKHLLAM-RNLRLLSLAGCP 529

  Fly   617 NITHERVYDILVNCPKLQLLDLSFC 641
            .:|...:.. ||...:|:.|:|:.|
Mouse   530 LLTTTGLSG-LVQLQELEELELTNC 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 10/47 (21%)
leucine-rich repeat 393..422 CDD:275381 7/34 (21%)
leucine-rich repeat 423..442 CDD:275381 4/18 (22%)
LRR_RI 437..>641 CDD:238064 55/213 (26%)
leucine-rich repeat 449..474 CDD:275381 8/27 (30%)
leucine-rich repeat 475..499 CDD:275381 2/23 (9%)
leucine-rich repeat 500..527 CDD:275381 7/32 (22%)
leucine-rich repeat 528..552 CDD:275381 8/24 (33%)
AMN1 552..>660 CDD:187754 28/90 (31%)
leucine-rich repeat 553..580 CDD:275381 10/26 (38%)
leucine-rich repeat 581..606 CDD:275381 6/24 (25%)
leucine-rich repeat 607..632 CDD:275381 7/24 (29%)
leucine-rich repeat 633..652 CDD:275381 4/9 (44%)
Fbxl16NP_001366323.1 PHA03247 <31..193 CDD:223021 23/121 (19%)
AMN1 297..509 CDD:187754 56/252 (22%)
leucine-rich repeat 316..339 CDD:275381 8/50 (16%)
leucine-rich repeat 340..365 CDD:275381 4/24 (17%)
leucine-rich repeat 366..391 CDD:275381 8/24 (33%)
leucine-rich repeat 392..417 CDD:275381 2/26 (8%)
leucine-rich repeat 418..443 CDD:275381 7/32 (22%)
leucine-rich repeat 444..469 CDD:275381 8/24 (33%)
leucine-rich repeat 470..494 CDD:275381 10/26 (38%)
leucine-rich repeat 495..514 CDD:275381 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.