DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and B0564.9

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_502528.2 Gene:B0564.9 / 178266 WormBaseID:WBGene00007208 Length:423 Species:Caenorhabditis elegans


Alignment Length:445 Identity:97/445 - (21%)
Similarity:174/445 - (39%) Gaps:128/445 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 DAIMLCGRTVTKTQNLLAKQ-------QITQHSRTLVSPPPDAIGSTSGDGSGGSISHKLRTLKF 286
            |||.| .||.:|..||::|.       .:..|..:::.   |::...|   .....|:.|:||..
 Worm    16 DAIRL-RRTSSKVDNLVSKSLKSMRHLDVQMHCPSVIR---DSVAMAS---VIAQCSYNLQTLDL 73

  Fly   287 QPNCGEDGATKLHEFINNDLSQFLADNCVDGEAAAPQICLTDLPFEILLR---ILSYLDLKSLFR 348
            :              |.:|.:::                 ..:|.::.:|   :.|..:..:..|
 Worm    74 K--------------IRSDNAKY-----------------AGIPSDVKIRRNVMTSINENATKLR 107

  Fly   349 VGHVSR---------TFYDISRHPLLYAEISLKPYWDVASSELLCTLARRATMLRKLDLSWCGGF 404
            ..|:.|         :|.|:   |....|||      :.:|.:.|:....||::||       .|
 Worm   108 KLHIDRCRISPGAIGSFGDL---PDSIEEIS------ITNSMIECSEWDVATIIRK-------SF 156

  Fly   405 GNVSPTEFKKFLTQRGDNLTHLRLNSCKFL-----NASCIENVGIVCDNLIELSLRNCATEPPLL 464
            |.:                    |..|:.|     :..|:.|             .:...:|.:|
 Worm   157 GTL--------------------LKKCRKLRYFEISGQCLMN-------------SHFHVDPKIL 188

  Fly   465 NFSCLANLKNLERLDLFQTYFETELLLSMLEGNRKLKHLNLAFCGVS-VNMDNVAAHLATYNTQL 528
            .|  ::|  .:|.|.:...:..|...|:.|: :::||.|||....:| .:::::.|...|    :
 Worm   189 QF--ISN--TVEHLAIAVGHSLTINSLAFLK-DKRLKTLNLQRSFISPCDLEHIVAMADT----I 244

  Fly   529 ISLDLWKA-HFLSSRGLQSLARLHQLEELDLGWCMREASLGDGLFQLLSNCPKLKKLFLSAVRGT 592
            ..|||.:: :.|..|.:..|..|..|...:    .:|....|.|..::.||.||::|.|......
 Worm   245 THLDLSRSVNLLDCRQIAELVNLRHLSLKN----NKEGVRDDSLQLIIKNCSKLEELSLDCCEYL 305

  Fly   593 TERDLMHIAALGKNLEQLDLMGILNITHERVYDILVNCPKLQLLDLSFCDNIMDR 647
            |...|:.:..| .||:||.|.||:|: .:.|...:..|.||..|:::||..:..|
 Worm   306 TVNSLITLGNL-NNLKQLSLPGIVNV-DDSVCLQISRCSKLTYLNINFCRRVQKR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 12/57 (21%)
leucine-rich repeat 393..422 CDD:275381 4/28 (14%)
leucine-rich repeat 423..442 CDD:275381 4/23 (17%)
LRR_RI 437..>641 CDD:238064 52/205 (25%)
leucine-rich repeat 449..474 CDD:275381 4/24 (17%)
leucine-rich repeat 475..499 CDD:275381 5/23 (22%)
leucine-rich repeat 500..527 CDD:275381 8/27 (30%)
leucine-rich repeat 528..552 CDD:275381 7/24 (29%)
AMN1 552..>660 CDD:187754 29/96 (30%)
leucine-rich repeat 553..580 CDD:275381 6/26 (23%)
leucine-rich repeat 581..606 CDD:275381 6/24 (25%)
leucine-rich repeat 607..632 CDD:275381 9/24 (38%)
leucine-rich repeat 633..652 CDD:275381 5/15 (33%)
B0564.9NP_502528.2 leucine-rich repeat 106..130 CDD:275381 6/26 (23%)
leucine-rich repeat 131..159 CDD:275381 11/40 (28%)
leucine-rich repeat 166..193 CDD:275381 6/41 (15%)
leucine-rich repeat 195..214 CDD:275381 4/18 (22%)
leucine-rich repeat 219..243 CDD:275381 7/23 (30%)
leucine-rich repeat 244..266 CDD:275381 6/21 (29%)
leucine-rich repeat 267..293 CDD:275381 7/29 (24%)
leucine-rich repeat 294..318 CDD:275381 6/24 (25%)
leucine-rich repeat 319..343 CDD:275381 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.