DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and FBXL14

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_689654.1 Gene:FBXL14 / 144699 HGNCID:28624 Length:418 Species:Homo sapiens


Alignment Length:433 Identity:106/433 - (24%)
Similarity:164/433 - (37%) Gaps:122/433 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 EILLRILSYLDLKSLFRVGHVSRTFYDISRHPLLYAEISLKPYWDVASSELLCTL----ARRATM 392
            |:|..|..|||::...|...|...:.|.:.|..::..:..|.:...|:..|..:|    .||..:
Human    11 ELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQI 75

  Fly   393 L----------------RKLDLSWC-----GGFGNVSPTEFKKFLTQRGDNLTHLRLNSCKFLNA 436
            |                ..|:||.|     .|.|:.       |:.:.| :|..|.|:.||.:..
Human    76 LSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHA-------FVQEIG-SLRALNLSLCKQITD 132

  Fly   437 S-------------------C--IENVGIV-----CDNLIELSLRNC-----------------A 458
            |                   |  |.|.|::     ...|..|:||:|                 |
Human   133 SSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSA 197

  Fly   459 TEPPLLNFSCLANLKNLERLDLFQTYFETELLLSML-EGNRKLKHLNLAFCG------------- 509
            .|      .||    .||:|.|......|:|.|..: .|...|:.|||:|||             
Human   198 AE------GCL----GLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHLSHM 252

  Fly   510 ---VSVNM---DNVA----AHLATYNTQLISLDLWKAHFLSSRGLQSLARLHQ----LEELDLGW 560
               .|:|:   ||::    .|||..:.:|..||:   .|....|.||||.:.|    |:.|.|  
Human   253 GSLRSLNLRSCDNISDTGIMHLAMGSLRLSGLDV---SFCDKVGDQSLAYIAQGLDGLKSLSL-- 312

  Fly   561 CMREASLGDGLFQLLSNCPKLKKLFLSAVRGTTERDLMHIAALGKNLEQLDLMGILNITHERVYD 625
            |....| .||:.:::.....|:.|.:......|::.|..||.....|..:||.|...|| :|..:
Human   313 CSCHIS-DDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRIT-KRGLE 375

  Fly   626 ILVNCPKLQLLDLSFCDNIMDRDFDLLAEWSRQFKVDIKSSRR 668
            .:...|.|::|:|... .:.|.:.:...::|..|.|..:.|.|
Human   376 RITQLPCLKVLNLGLW-QMTDSEKEARGDFSPLFTVRTRGSSR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 10/39 (26%)
leucine-rich repeat 393..422 CDD:275381 9/49 (18%)
leucine-rich repeat 423..442 CDD:275381 8/39 (21%)
LRR_RI 437..>641 CDD:238064 70/274 (26%)
leucine-rich repeat 449..474 CDD:275381 9/41 (22%)
leucine-rich repeat 475..499 CDD:275381 8/24 (33%)
leucine-rich repeat 500..527 CDD:275381 14/49 (29%)
leucine-rich repeat 528..552 CDD:275381 9/23 (39%)
AMN1 552..>660 CDD:187754 27/111 (24%)
leucine-rich repeat 553..580 CDD:275381 7/26 (27%)
leucine-rich repeat 581..606 CDD:275381 6/24 (25%)
leucine-rich repeat 607..632 CDD:275381 7/24 (29%)
leucine-rich repeat 633..652 CDD:275381 4/18 (22%)
FBXL14NP_689654.1 Required for down-regulation of SNAI1 2..48 10/36 (28%)
F-box-like 5..46 CDD:403981 10/34 (29%)
AMN1 90..296 CDD:187754 54/226 (24%)
leucine-rich repeat 92..118 CDD:275381 8/33 (24%)
leucine-rich repeat 119..142 CDD:275381 6/22 (27%)
LRR 1 144..163 4/18 (22%)
leucine-rich repeat 145..170 CDD:275381 4/24 (17%)
LRR 2 170..191 5/20 (25%)
leucine-rich repeat 171..203 CDD:275381 9/41 (22%)
LRR 3 203..225 7/21 (33%)
leucine-rich repeat 204..229 CDD:275381 8/24 (33%)
AMN1 228..401 CDD:187754 49/180 (27%)
LRR 4 229..250 7/20 (35%)
leucine-rich repeat 230..254 CDD:275381 7/23 (30%)
LRR 5 254..275 5/20 (25%)
leucine-rich repeat 255..280 CDD:275381 7/24 (29%)
leucine-rich repeat 281..306 CDD:275381 10/27 (37%)
leucine-rich repeat 307..331 CDD:275381 7/26 (27%)
leucine-rich repeat 332..357 CDD:275381 6/24 (25%)
leucine-rich repeat 358..382 CDD:275381 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.