DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbxl4 and fbxl12

DIOPT Version :9

Sequence 1:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_002933934.2 Gene:fbxl12 / 100135148 XenbaseID:XB-GENE-942694 Length:350 Species:Xenopus tropicalis


Alignment Length:346 Identity:86/346 - (24%)
Similarity:137/346 - (39%) Gaps:64/346 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 INNDLSQFLADNCVDGEAAAPQICLTDLPFEILLRILSYLDLKSLFRVGHVSRTFYDISRHPLLY 366
            ::.:.|.....:..:..:.:..:.|:.||..:||.:||:|.::.|.|.|.|.:.:..:.....|:
 Frog    21 VSMETSMSALPSAAENSSVSGTLALSWLPDSVLLEVLSFLSIRDLVRSGRVCKRWRTLVMDKTLW 85

  Fly   367 AEISLKPYWDVASSELLCTLARRATMLRKLDLSWCGGFGNVSPTEF-----KKFLTQRGDNL--- 423
            ..|:|.||  ...|:.|..|.|...:.....|...|...:|...||     .|.:..|..||   
 Frog    86 RHINLTPY--KLDSKTLWHLVRHKFVPSLQTLKLRGTLRSVKKQEFLTMAVLKEIESRFHNLETL 148

  Fly   424 ------------TH-------LRLNSCKFLNASCIE---NVGIVCDNLIELSLRNCATEPPLLN- 465
                        .|       |:||.|: |.|:..:   |.|.....|..|.|.:.   |...| 
 Frog   149 HLEQTNLHSLSYCHFPSTLKTLQLNQCE-LPANWFKTPPNKGRTFPKLEHLFLNSV---PSFSNH 209

  Fly   466 -FSCLANLKNLERLDLFQTYFETEL----LLSMLEGNRKLKHLNLAFCGVS-VNMDNVAAHLATY 524
             ...:.:|..|:.|.|..||..|:.    .|..|:|   |:||.|..|.:| :.:..:..||   
 Frog   210 HLETICSLSALKTLSLCGTYRVTDAGIPDSLPHLKG---LEHLKLQGCYISDITLHLIGCHL--- 268

  Fly   525 NTQLISLDLWKAHFLSSRGLQSLARLHQLEELDLGWCMREASLGDGLFQLLSNCPKLKKLFLSAV 589
             ..|.:|.|.....:|..||..|:.:..||:|   |.  |.|....|..:::.|.||..|....:
 Frog   269 -KHLQTLALTDVSSVSDAGLACLSSVKTLEKL---WL--EYSTHLSLNSIIAVCGKLPALSYLHL 327

  Fly   590 RGTTERDLMHIAALGKNLEQL 610
            .||.|         |:.:::|
 Frog   328 NGTFE---------GRGIDEL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 14/45 (31%)
leucine-rich repeat 393..422 CDD:275381 7/33 (21%)
leucine-rich repeat 423..442 CDD:275381 8/43 (19%)
LRR_RI 437..>641 CDD:238064 48/184 (26%)
leucine-rich repeat 449..474 CDD:275381 6/26 (23%)
leucine-rich repeat 475..499 CDD:275381 9/27 (33%)
leucine-rich repeat 500..527 CDD:275381 8/27 (30%)
leucine-rich repeat 528..552 CDD:275381 7/23 (30%)
AMN1 552..>660 CDD:187754 16/59 (27%)
leucine-rich repeat 553..580 CDD:275381 8/26 (31%)
leucine-rich repeat 581..606 CDD:275381 6/24 (25%)
leucine-rich repeat 607..632 CDD:275381 1/4 (25%)
leucine-rich repeat 633..652 CDD:275381
fbxl12XP_002933934.2 F-box-like 45..88 CDD:372399 13/42 (31%)
leucine-rich repeat 60..84 CDD:275381 5/23 (22%)
leucine-rich repeat 85..107 CDD:275381 8/23 (35%)
leucine-rich repeat 112..144 CDD:275381 7/31 (23%)
leucine-rich repeat 145..194 CDD:275381 10/49 (20%)
leucine-rich repeat 195..219 CDD:275381 6/26 (23%)
LRR_RI <216..343 CDD:393385 41/145 (28%)
leucine-rich repeat 220..245 CDD:275381 8/24 (33%)
leucine-rich repeat 246..270 CDD:275381 8/27 (30%)
leucine-rich repeat 271..295 CDD:275381 7/23 (30%)
leucine-rich repeat 296..321 CDD:275381 10/29 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.