DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1434 and DUS4

DIOPT Version :9

Sequence 1:NP_001285237.1 Gene:CG1434 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_013509.1 Gene:DUS4 / 851121 SGDID:S000004397 Length:367 Species:Saccharomyces cerevisiae


Alignment Length:317 Identity:86/317 - (27%)
Similarity:141/317 - (44%) Gaps:56/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MKTRQRLDYRNKLILAPMVRVGTLPMRLLALEMGADIVYTEELVDIKLIKSIRRPNPALGTVDFV 78
            :||||:...|...|..||||...||.|.|..|...||||                :|.:...::|
Yeast    29 IKTRQKTHGRPVTIAGPMVRYSKLPFRQLCREYNVDIVY----------------SPMILAREYV 77

  Fly    79 DPSDGTIVFRTCAQETSRLVLQMGTSDAGRALAVGKLLQRDISGLDINMGCPKEFSIKGGMGAAL 143
            ......|...:...|.:.|::|:|.::....|...:::.....|:.||.|||.:..|:.|:|.||
Yeast    78 RNEHARISDLSTNNEDTPLIVQVGVNNVADLLKFVEMVAPYCDGIGINCGCPIKEQIREGIGCAL 142

  Fly   144 LADPDKAAHILRTLCS---------GLDIPVTCKIRILPDVEGTIDLVQKLAATGIAAIGIHART 199
            :.:.|       .|||         |..:.:..||||...::.|::|.:||...|:..|.||.||
Yeast   143 IYNSD-------LLCSMVHAVKDKYGDKLRIETKIRIHEALDETVELCRKLCDAGVDWITIHGRT 200

  Fly   200 RDERPQHPAHPEVLRAVAQAV---DIPIIANGGSKNMHCY--DDLRKFQMECGADSVMVARAAQI 259
            |..|...||:.:.::.:.:.:   ::|:||||     .|:  .||.:.....||..||..|....
Yeast   201 RRTRSSQPANLDAIKYIIENISDKNVPVIANG-----DCFKLSDLERITKYTGAHGVMAVRGLLS 260

  Fly   260 NVSIFRPEGLLPMDELIEKYLRLCVDYDNAP-----HNAKYCV-------QSILREL 304
            |.::|......|.. .|||:....:::...|     |:. ||:       :|:|:::
Yeast   261 NPALFAGYTTCPWG-CIEKFCYWALEFGGLPFQLAQHHL-YCMLENMELKKSLLKKM 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1434NP_001285237.1 DusA 14..287 CDD:223120 80/286 (28%)
DUS_like_FMN 25..266 CDD:239200 71/254 (28%)
Rnc <317..461 CDD:223644
DSRM 395..457 CDD:238007
DUS4NP_013509.1 Dus 45..361 CDD:395964 80/301 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.