DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1434 and DUS3

DIOPT Version :9

Sequence 1:NP_001285237.1 Gene:CG1434 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_013505.4 Gene:DUS3 / 851117 SGDID:S000004393 Length:668 Species:Saccharomyces cerevisiae


Alignment Length:415 Identity:110/415 - (26%)
Similarity:172/415 - (41%) Gaps:93/415 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RQRLDYRNKLILAPMVRVGTLPMRLLALEMGADIVYTEELVDIKLIKSIRR--PNPALGTVDFVD 79
            ::.||..:|.|::|:..||.||.|.|..::|||:.|:|..:.:.||:....  ..|...|.:|  
Yeast   286 KKPLDLYHKKIVSPLTTVGNLPYRRLMRKLGADVTYSEMALAVPLIQGTNSEWALPKAHTSEF-- 348

  Fly    80 PSDGTIVFRTCAQETSRLVLQMGTSDAGRALAVGKLLQR---DISGLDINMGCPKEFSIKGGMGA 141
            |..|               :|:..|.|.:|....:.|..   :||.:::|.|||.:...:.|.|:
Yeast   349 PGFG---------------VQVACSKAWQAAKAAEALANSVSEISEINLNSGCPIDLLYRQGSGS 398

  Fly   142 ALLADPDKAAHILRTLCS----GLDIPVTCKIRI-----LPDVEGTIDLVQKLA-ATGIAAIGIH 196
            |||.:|   |.::|.|.:    ..|||:|.|||.     .|..||   ||::|. .|.:|||.:|
Yeast   399 ALLDNP---ARMIRCLNAMNYVSKDIPITVKIRTGTKEGHPIAEG---LVKRLVNETDVAAITLH 457

  Fly   197 ARTRDERPQHPAHPEVLRAVAQAV---------------------DIPIIANGGSKNMHCYDDLR 240
            .|:|.:|....|..:.:..||..:                     .|..:.||...|..  |..|
Yeast   458 GRSRQQRYTKSADWDYVSQVADTLRSAEADFIETEQGKEGRDSKNRIQFVGNGDVNNFE--DWYR 520

  Fly   241 KFQMECGADSVMVARAAQINVSIFRP-EGLLPMDELIEKYLRLCVDYDNAPHNAKYCVQSILREL 304
            ........|||||||.|.|...||.. |....:|:...:.|.:..||      |::.::....:.
Yeast   521 YLNGNENIDSVMVARGALIKPWIFEEVESQQYLDKTSTERLDILRDY------AQFSMEHWGTDE 579

  Fly   305 QETPRGKRFLQCQTL--------QQICEIWEL------GDYCRRKQRELKTMGNSGRAEVEPPEA 355
            ....:.:||. |:.:        ..|||.:.:      .::|.|.  ||:|:  .|..:|.    
Yeast   580 YGISQCRRFF-CEFMSFFHRYVPMGICERYPVKLNERPPNWCGRD--ELETL--MGSTDVN---- 635

  Fly   356 LAKRQKLEDAAIAITDEYDGIICRH 380
              ...||.|.....|||....:.:|
Yeast   636 --DWIKLSDLFFGKTDENFVFVPKH 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1434NP_001285237.1 DusA 14..287 CDD:223120 88/306 (29%)
DUS_like_FMN 25..266 CDD:239200 82/276 (30%)
Rnc <317..461 CDD:223644 17/78 (22%)
DSRM 395..457 CDD:238007
DUS3NP_013505.4 zf-CCCH_4 96..120 CDD:407881
DusA 284..597 CDD:223120 93/342 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.